Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7AA37

Protein Details
Accession A0A3M7AA37    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76VTGQKPQGRRRARSEDRKEEBasic
NLS Segment(s)
PositionSequence
65-68RRRA
Subcellular Location(s) cyto 9, plas 6, mito 5, nucl 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADQAPTQQSKADKFMRGAGEVRDTNLWGPAKWVVQLVQYMVAIIMITIGEGFKAIVTGQKPQGRRRARSEDRKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.39
4 0.37
5 0.35
6 0.3
7 0.3
8 0.27
9 0.27
10 0.22
11 0.2
12 0.18
13 0.21
14 0.19
15 0.13
16 0.15
17 0.15
18 0.15
19 0.14
20 0.15
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.04
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.02
41 0.03
42 0.03
43 0.07
44 0.09
45 0.14
46 0.21
47 0.26
48 0.31
49 0.38
50 0.48
51 0.54
52 0.59
53 0.64
54 0.67
55 0.73
56 0.8