Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6YEI1

Protein Details
Accession A0A3M6YEI1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
255-282EARKLENKLLKNKNQKNKRDKEIAKLREHydrophilic
NLS Segment(s)
PositionSequence
264-279LKNKNQKNKRDKEIAK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, plas 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041622  SLATT_fungi  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF18142  SLATT_fungal  
Amino Acid Sequences MGSRLSRHSSDGDAEKGHAGPIDAQAGHQASRSDQRTPVYDGAPVSEFAQQHGVSELEVFQTLVGIHFVRYGGGALPNRQKPPASVFKDIFLPGQAAAARFRNRGLYDRTLSHDMKNRVLYGIARYIIIFLFLLQVVIAATVTALAADEGRTSNTALTALGAVNTVLAGILAWLNGQGMPTRFRRSRDKFREVVHAIENAERTFAEIDYIEWDEGTRPNPIKERDRLEKLYEEARLDMEANYPETQNGSGEQQAEARKLENKLLKNKNQKNKRDKEIAKLREKTEVLEGDSKELKELKLEKEKLRNELERIKEEGEQFGERALDAFAGAKERLEQAGESSEDGSLDTKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.25
5 0.19
6 0.16
7 0.14
8 0.16
9 0.18
10 0.16
11 0.16
12 0.2
13 0.21
14 0.2
15 0.2
16 0.18
17 0.17
18 0.26
19 0.29
20 0.28
21 0.31
22 0.34
23 0.35
24 0.41
25 0.41
26 0.34
27 0.33
28 0.3
29 0.29
30 0.27
31 0.24
32 0.19
33 0.2
34 0.19
35 0.17
36 0.22
37 0.19
38 0.18
39 0.19
40 0.18
41 0.13
42 0.14
43 0.13
44 0.09
45 0.09
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.13
61 0.15
62 0.2
63 0.28
64 0.34
65 0.35
66 0.37
67 0.36
68 0.33
69 0.39
70 0.44
71 0.42
72 0.43
73 0.42
74 0.41
75 0.44
76 0.42
77 0.35
78 0.25
79 0.2
80 0.13
81 0.14
82 0.13
83 0.11
84 0.13
85 0.18
86 0.2
87 0.2
88 0.21
89 0.23
90 0.24
91 0.28
92 0.32
93 0.33
94 0.33
95 0.35
96 0.39
97 0.4
98 0.4
99 0.39
100 0.41
101 0.37
102 0.39
103 0.39
104 0.34
105 0.28
106 0.28
107 0.25
108 0.2
109 0.2
110 0.16
111 0.14
112 0.14
113 0.14
114 0.12
115 0.12
116 0.09
117 0.05
118 0.06
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.03
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.03
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.03
162 0.03
163 0.03
164 0.05
165 0.06
166 0.09
167 0.12
168 0.18
169 0.21
170 0.25
171 0.35
172 0.42
173 0.53
174 0.59
175 0.64
176 0.62
177 0.62
178 0.67
179 0.58
180 0.53
181 0.43
182 0.35
183 0.29
184 0.26
185 0.25
186 0.15
187 0.14
188 0.11
189 0.1
190 0.09
191 0.08
192 0.07
193 0.06
194 0.07
195 0.08
196 0.09
197 0.08
198 0.07
199 0.08
200 0.08
201 0.09
202 0.1
203 0.13
204 0.13
205 0.16
206 0.22
207 0.27
208 0.33
209 0.37
210 0.43
211 0.47
212 0.52
213 0.53
214 0.51
215 0.48
216 0.44
217 0.41
218 0.37
219 0.3
220 0.23
221 0.21
222 0.18
223 0.16
224 0.14
225 0.12
226 0.11
227 0.13
228 0.13
229 0.12
230 0.12
231 0.12
232 0.12
233 0.1
234 0.11
235 0.1
236 0.11
237 0.12
238 0.12
239 0.15
240 0.17
241 0.18
242 0.18
243 0.18
244 0.2
245 0.21
246 0.27
247 0.3
248 0.35
249 0.43
250 0.52
251 0.6
252 0.67
253 0.74
254 0.78
255 0.82
256 0.86
257 0.87
258 0.87
259 0.86
260 0.85
261 0.8
262 0.8
263 0.81
264 0.8
265 0.79
266 0.76
267 0.69
268 0.66
269 0.63
270 0.54
271 0.5
272 0.43
273 0.37
274 0.37
275 0.35
276 0.32
277 0.34
278 0.32
279 0.28
280 0.28
281 0.24
282 0.24
283 0.29
284 0.33
285 0.4
286 0.46
287 0.51
288 0.59
289 0.63
290 0.64
291 0.67
292 0.64
293 0.6
294 0.63
295 0.62
296 0.57
297 0.56
298 0.51
299 0.47
300 0.43
301 0.4
302 0.36
303 0.31
304 0.26
305 0.24
306 0.22
307 0.17
308 0.17
309 0.13
310 0.09
311 0.08
312 0.09
313 0.08
314 0.12
315 0.12
316 0.12
317 0.13
318 0.15
319 0.16
320 0.16
321 0.15
322 0.14
323 0.19
324 0.2
325 0.19
326 0.18
327 0.17
328 0.16
329 0.16
330 0.15