Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6ZIJ5

Protein Details
Accession A0A3M6ZIJ5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-76NAAVKGGRGKKRKSRKAGRGRPPKSAABasic
NLS Segment(s)
PositionSequence
54-73KGGRGKKRKSRKAGRGRPPK
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046341  SET_dom_sf  
Amino Acid Sequences MAKDTPFKAYNLERRGLLHTIPTPPAKTTRHRMDRQVWARAISEAPSTGNAAVKGGRGKKRKSRKAGRGRPPKSAADVVRCRSQEAMCLHCGRYSDDPACGPKCYTSFRASTFLPSSSIEIRGPGETGYGAFTAPGVRISKGQWLDEYIGELLPLPSPDIPSKNPTSLYQLWIPGTAIIDASRAGNWTRFINSSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.43
4 0.35
5 0.31
6 0.29
7 0.31
8 0.34
9 0.35
10 0.32
11 0.31
12 0.38
13 0.37
14 0.41
15 0.47
16 0.53
17 0.6
18 0.63
19 0.69
20 0.7
21 0.76
22 0.76
23 0.74
24 0.65
25 0.57
26 0.52
27 0.45
28 0.38
29 0.28
30 0.23
31 0.15
32 0.14
33 0.12
34 0.13
35 0.12
36 0.13
37 0.11
38 0.11
39 0.11
40 0.12
41 0.17
42 0.23
43 0.31
44 0.37
45 0.44
46 0.53
47 0.64
48 0.72
49 0.77
50 0.81
51 0.83
52 0.88
53 0.91
54 0.91
55 0.92
56 0.85
57 0.83
58 0.77
59 0.67
60 0.6
61 0.56
62 0.48
63 0.45
64 0.47
65 0.42
66 0.43
67 0.41
68 0.37
69 0.33
70 0.3
71 0.28
72 0.24
73 0.24
74 0.21
75 0.23
76 0.23
77 0.22
78 0.23
79 0.19
80 0.19
81 0.19
82 0.18
83 0.17
84 0.18
85 0.2
86 0.2
87 0.18
88 0.16
89 0.14
90 0.15
91 0.17
92 0.2
93 0.2
94 0.21
95 0.22
96 0.26
97 0.24
98 0.26
99 0.24
100 0.21
101 0.2
102 0.18
103 0.18
104 0.16
105 0.18
106 0.14
107 0.13
108 0.13
109 0.12
110 0.12
111 0.1
112 0.09
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.05
119 0.05
120 0.06
121 0.06
122 0.09
123 0.09
124 0.09
125 0.11
126 0.12
127 0.19
128 0.21
129 0.21
130 0.19
131 0.2
132 0.22
133 0.2
134 0.21
135 0.15
136 0.13
137 0.12
138 0.11
139 0.09
140 0.08
141 0.08
142 0.08
143 0.08
144 0.11
145 0.14
146 0.18
147 0.2
148 0.25
149 0.29
150 0.31
151 0.33
152 0.32
153 0.37
154 0.35
155 0.37
156 0.34
157 0.33
158 0.31
159 0.3
160 0.28
161 0.21
162 0.2
163 0.16
164 0.13
165 0.1
166 0.1
167 0.09
168 0.1
169 0.09
170 0.1
171 0.11
172 0.14
173 0.16
174 0.18
175 0.21