Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6YZJ4

Protein Details
Accession A0A3M6YZJ4    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-134GYAAGRRKDRSRSRRRRDDYSDYSDBasic
338-384KAIYDRVRSKSRNRRSPSRSSSADSYVPSRNRRRDMRRSPRSDMDGRHydrophilic
NLS Segment(s)
PositionSequence
114-126GRRKDRSRSRRRR
139-147RSERKERRK
168-197GKKDHSRSGSRGGRSARSRSRGPRSRRHSS
268-317PISKSRSRGRDRAASPDAGPRSRSRSIIDRFRGRSRSRARSEAGSDKSGK
343-356RVRSKSRNRRSPSR
367-376RNRRRDMRRS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSAYADSSRTRPRDRDEPDYVREDVYIERGKGPGPRDLVFRGRDDSVEDIPRDFPPPRAQDYRRSRDYDDYTSRASRSAAGRRGGRYDDDYYDDDRYTDYAAPVAGGAAGYAAGRRKDRSRSRRRRDDYSDYSDSPPPRSERKERRKSGFEEAIAGLGLGGLAGGLMGKKDHSRSGSRGGRSARSRSRGPRSRRHSSSSRSSSAVEAFRARNEPGPWSGDKGKRIATAALGAGGIDGLIDRNPNKKSKRHLAEAVIGGVAASRLANGPISKSRSRGRDRAASPDAGPRSRSRSIIDRFRGRSRSRARSEAGSDKSGKSGSFGAVKGLAAGGALAAAGKAIYDRVRSKSRNRRSPSRSSSADSYVPSRNRRRDMRRSPRSDMDGRSIRPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.7
4 0.69
5 0.68
6 0.66
7 0.6
8 0.5
9 0.43
10 0.36
11 0.27
12 0.28
13 0.27
14 0.24
15 0.25
16 0.25
17 0.27
18 0.3
19 0.32
20 0.31
21 0.3
22 0.3
23 0.33
24 0.37
25 0.42
26 0.41
27 0.41
28 0.38
29 0.35
30 0.33
31 0.32
32 0.31
33 0.29
34 0.31
35 0.29
36 0.26
37 0.27
38 0.28
39 0.3
40 0.27
41 0.26
42 0.3
43 0.35
44 0.4
45 0.48
46 0.5
47 0.56
48 0.66
49 0.7
50 0.69
51 0.68
52 0.64
53 0.64
54 0.67
55 0.65
56 0.61
57 0.55
58 0.53
59 0.5
60 0.47
61 0.4
62 0.34
63 0.3
64 0.3
65 0.35
66 0.37
67 0.41
68 0.45
69 0.46
70 0.49
71 0.47
72 0.43
73 0.39
74 0.36
75 0.32
76 0.32
77 0.32
78 0.3
79 0.3
80 0.27
81 0.22
82 0.19
83 0.17
84 0.15
85 0.14
86 0.12
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.06
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.05
99 0.07
100 0.1
101 0.12
102 0.16
103 0.21
104 0.31
105 0.42
106 0.52
107 0.61
108 0.7
109 0.79
110 0.87
111 0.88
112 0.88
113 0.86
114 0.84
115 0.81
116 0.78
117 0.72
118 0.63
119 0.6
120 0.56
121 0.48
122 0.41
123 0.37
124 0.32
125 0.34
126 0.38
127 0.46
128 0.52
129 0.62
130 0.7
131 0.75
132 0.79
133 0.79
134 0.77
135 0.75
136 0.7
137 0.59
138 0.51
139 0.43
140 0.35
141 0.28
142 0.23
143 0.13
144 0.07
145 0.06
146 0.03
147 0.02
148 0.01
149 0.01
150 0.01
151 0.02
152 0.02
153 0.02
154 0.02
155 0.03
156 0.05
157 0.07
158 0.1
159 0.13
160 0.17
161 0.2
162 0.3
163 0.35
164 0.35
165 0.39
166 0.39
167 0.42
168 0.42
169 0.47
170 0.43
171 0.42
172 0.46
173 0.49
174 0.57
175 0.6
176 0.63
177 0.66
178 0.67
179 0.72
180 0.71
181 0.69
182 0.66
183 0.63
184 0.65
185 0.61
186 0.56
187 0.48
188 0.44
189 0.39
190 0.35
191 0.3
192 0.22
193 0.19
194 0.17
195 0.17
196 0.18
197 0.18
198 0.18
199 0.17
200 0.18
201 0.17
202 0.2
203 0.19
204 0.21
205 0.27
206 0.28
207 0.29
208 0.29
209 0.29
210 0.27
211 0.28
212 0.25
213 0.18
214 0.16
215 0.14
216 0.12
217 0.09
218 0.08
219 0.06
220 0.05
221 0.04
222 0.03
223 0.02
224 0.02
225 0.03
226 0.04
227 0.06
228 0.11
229 0.15
230 0.23
231 0.28
232 0.34
233 0.42
234 0.52
235 0.57
236 0.59
237 0.62
238 0.58
239 0.59
240 0.54
241 0.46
242 0.35
243 0.28
244 0.21
245 0.15
246 0.1
247 0.05
248 0.03
249 0.03
250 0.03
251 0.04
252 0.06
253 0.06
254 0.09
255 0.15
256 0.21
257 0.23
258 0.27
259 0.33
260 0.41
261 0.47
262 0.52
263 0.52
264 0.56
265 0.56
266 0.61
267 0.59
268 0.51
269 0.46
270 0.46
271 0.44
272 0.36
273 0.37
274 0.31
275 0.34
276 0.35
277 0.36
278 0.32
279 0.37
280 0.43
281 0.51
282 0.56
283 0.58
284 0.6
285 0.66
286 0.71
287 0.64
288 0.66
289 0.66
290 0.68
291 0.66
292 0.67
293 0.62
294 0.6
295 0.63
296 0.62
297 0.57
298 0.51
299 0.48
300 0.42
301 0.42
302 0.37
303 0.3
304 0.23
305 0.21
306 0.19
307 0.2
308 0.2
309 0.19
310 0.19
311 0.19
312 0.17
313 0.15
314 0.12
315 0.07
316 0.07
317 0.04
318 0.03
319 0.03
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.03
326 0.05
327 0.08
328 0.14
329 0.18
330 0.25
331 0.35
332 0.41
333 0.52
334 0.61
335 0.7
336 0.74
337 0.79
338 0.83
339 0.82
340 0.87
341 0.85
342 0.83
343 0.77
344 0.72
345 0.69
346 0.63
347 0.59
348 0.5
349 0.46
350 0.46
351 0.48
352 0.52
353 0.56
354 0.61
355 0.66
356 0.74
357 0.8
358 0.83
359 0.87
360 0.89
361 0.9
362 0.89
363 0.88
364 0.86
365 0.84
366 0.8
367 0.73
368 0.72
369 0.69
370 0.63