Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VR80

Protein Details
Accession K1VR80    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
381-403EDRLPTHLKNKWRINRPVPEAPSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 11.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006076  FAD-dep_OxRdtase  
IPR036188  FAD/NAD-bd_sf  
IPR045170  MTOX  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF01266  DAO  
Amino Acid Sequences MELFPKTKVVVIGAGELGATAAVSLAESGHYDVTVLDRAPILPAEDAASTDINKAVRADYIDRDYAVLAQESIRRWRGKEWEGVYHETGVLQRNLTRPEAVELFAAVQSLDPEGVRKLSSSEIRARLGPGSEGSAALQQSAYYNPSGGWAWSSGAIEKLYARLRELNVSIVPSAELAELIRDGDAVVGVKLTDGREFRADKVIAALGSWTGGHPALKGLLPKGLLVPTGQTVAAVQLSPEEMEIYRDIPVNATQDGTGYYAFPPTASGVMKFALHSGGYTVPNDVPRTVLDPAAAAYAQEKGVGWIPRKSLALLREKLGEGFPALAKRKLKYTRMCYYSDTPDGDFVIDYAAPGLLVASGGAGHAFKFLPVMGEIIHARLEDRLPTHLKNKWRINRPVPEAPSDDDRQGFGRQPLDLESLATTAEMGAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.13
4 0.11
5 0.07
6 0.06
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.04
14 0.05
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.1
21 0.12
22 0.11
23 0.11
24 0.11
25 0.12
26 0.13
27 0.14
28 0.13
29 0.11
30 0.11
31 0.12
32 0.11
33 0.12
34 0.12
35 0.13
36 0.11
37 0.12
38 0.14
39 0.13
40 0.14
41 0.14
42 0.13
43 0.14
44 0.17
45 0.2
46 0.22
47 0.26
48 0.26
49 0.26
50 0.25
51 0.24
52 0.21
53 0.19
54 0.15
55 0.1
56 0.11
57 0.15
58 0.17
59 0.23
60 0.28
61 0.29
62 0.31
63 0.37
64 0.43
65 0.45
66 0.51
67 0.49
68 0.51
69 0.54
70 0.56
71 0.51
72 0.43
73 0.38
74 0.3
75 0.28
76 0.23
77 0.19
78 0.16
79 0.18
80 0.21
81 0.24
82 0.25
83 0.24
84 0.21
85 0.24
86 0.24
87 0.22
88 0.17
89 0.15
90 0.14
91 0.13
92 0.12
93 0.08
94 0.07
95 0.06
96 0.06
97 0.06
98 0.05
99 0.06
100 0.07
101 0.09
102 0.09
103 0.09
104 0.1
105 0.14
106 0.18
107 0.22
108 0.28
109 0.31
110 0.33
111 0.33
112 0.33
113 0.29
114 0.27
115 0.23
116 0.16
117 0.14
118 0.13
119 0.12
120 0.12
121 0.12
122 0.12
123 0.11
124 0.1
125 0.08
126 0.08
127 0.09
128 0.1
129 0.08
130 0.08
131 0.07
132 0.09
133 0.1
134 0.09
135 0.09
136 0.08
137 0.08
138 0.09
139 0.1
140 0.08
141 0.1
142 0.09
143 0.09
144 0.09
145 0.12
146 0.14
147 0.14
148 0.16
149 0.18
150 0.19
151 0.21
152 0.22
153 0.2
154 0.17
155 0.18
156 0.16
157 0.12
158 0.12
159 0.09
160 0.08
161 0.06
162 0.05
163 0.04
164 0.05
165 0.04
166 0.05
167 0.04
168 0.04
169 0.04
170 0.03
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.05
178 0.05
179 0.08
180 0.08
181 0.1
182 0.14
183 0.15
184 0.16
185 0.22
186 0.21
187 0.18
188 0.19
189 0.18
190 0.14
191 0.13
192 0.12
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.07
204 0.07
205 0.07
206 0.09
207 0.09
208 0.09
209 0.1
210 0.09
211 0.08
212 0.08
213 0.08
214 0.07
215 0.07
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.06
230 0.06
231 0.07
232 0.08
233 0.09
234 0.09
235 0.09
236 0.11
237 0.11
238 0.11
239 0.1
240 0.09
241 0.09
242 0.09
243 0.09
244 0.08
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.07
251 0.07
252 0.09
253 0.08
254 0.09
255 0.09
256 0.1
257 0.1
258 0.1
259 0.09
260 0.08
261 0.08
262 0.07
263 0.07
264 0.1
265 0.11
266 0.11
267 0.12
268 0.12
269 0.15
270 0.16
271 0.15
272 0.13
273 0.13
274 0.16
275 0.15
276 0.14
277 0.12
278 0.11
279 0.11
280 0.11
281 0.1
282 0.07
283 0.06
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.12
290 0.16
291 0.18
292 0.21
293 0.22
294 0.25
295 0.26
296 0.26
297 0.25
298 0.28
299 0.34
300 0.33
301 0.33
302 0.33
303 0.33
304 0.33
305 0.29
306 0.23
307 0.14
308 0.14
309 0.14
310 0.17
311 0.2
312 0.24
313 0.27
314 0.28
315 0.36
316 0.43
317 0.5
318 0.53
319 0.59
320 0.63
321 0.64
322 0.66
323 0.62
324 0.59
325 0.57
326 0.52
327 0.45
328 0.37
329 0.34
330 0.31
331 0.26
332 0.2
333 0.14
334 0.11
335 0.09
336 0.08
337 0.07
338 0.06
339 0.05
340 0.05
341 0.05
342 0.03
343 0.03
344 0.03
345 0.03
346 0.03
347 0.03
348 0.04
349 0.04
350 0.04
351 0.06
352 0.06
353 0.06
354 0.07
355 0.07
356 0.08
357 0.09
358 0.09
359 0.08
360 0.11
361 0.12
362 0.12
363 0.13
364 0.11
365 0.11
366 0.13
367 0.14
368 0.14
369 0.15
370 0.21
371 0.25
372 0.29
373 0.35
374 0.39
375 0.47
376 0.53
377 0.62
378 0.66
379 0.71
380 0.77
381 0.81
382 0.85
383 0.84
384 0.84
385 0.77
386 0.73
387 0.66
388 0.6
389 0.57
390 0.5
391 0.45
392 0.37
393 0.34
394 0.32
395 0.31
396 0.32
397 0.3
398 0.3
399 0.27
400 0.27
401 0.29
402 0.3
403 0.27
404 0.23
405 0.19
406 0.17
407 0.16
408 0.15
409 0.11