Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6Y702

Protein Details
Accession A0A3M6Y702    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
170-195LERRIKSKGNVKEKANKRKSENEYSYHydrophilic
NLS Segment(s)
PositionSequence
173-188RIKSKGNVKEKANKRK
Subcellular Location(s) plas 20, extr 4, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAQPLRLPILASAALSICLSLAIIGCAGRSLSIFDDQQASNVWLLPIWPNHFDTRELHALIGTSAAVMILNFILIATLFIQKLPTTLLLLASSSLSTICALVAIAFPATLNAHAPRRDTLRSWTCRWSNTLVTQGQGPPAQFDTLCKETVRTTRPCLVGVWFVSSYASPLERRIKSKGNVKEKANKRKSENEYSYQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.05
16 0.06
17 0.07
18 0.09
19 0.12
20 0.12
21 0.13
22 0.17
23 0.17
24 0.17
25 0.17
26 0.17
27 0.14
28 0.14
29 0.13
30 0.09
31 0.1
32 0.12
33 0.14
34 0.16
35 0.17
36 0.19
37 0.22
38 0.23
39 0.25
40 0.24
41 0.27
42 0.28
43 0.26
44 0.23
45 0.21
46 0.2
47 0.18
48 0.15
49 0.09
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.07
99 0.11
100 0.12
101 0.14
102 0.15
103 0.19
104 0.21
105 0.22
106 0.28
107 0.34
108 0.38
109 0.4
110 0.45
111 0.44
112 0.44
113 0.45
114 0.41
115 0.36
116 0.33
117 0.36
118 0.29
119 0.27
120 0.27
121 0.25
122 0.23
123 0.21
124 0.18
125 0.14
126 0.14
127 0.15
128 0.13
129 0.14
130 0.18
131 0.19
132 0.2
133 0.18
134 0.19
135 0.22
136 0.29
137 0.34
138 0.31
139 0.35
140 0.4
141 0.42
142 0.41
143 0.38
144 0.34
145 0.32
146 0.29
147 0.28
148 0.21
149 0.19
150 0.19
151 0.18
152 0.16
153 0.13
154 0.15
155 0.11
156 0.17
157 0.27
158 0.3
159 0.35
160 0.4
161 0.47
162 0.52
163 0.6
164 0.64
165 0.66
166 0.69
167 0.72
168 0.77
169 0.79
170 0.83
171 0.83
172 0.81
173 0.77
174 0.8
175 0.81
176 0.82
177 0.79