Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7AHS4

Protein Details
Accession A0A3M7AHS4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-77AVPLRKHLKDEAKRKKNAAKABasic
NLS Segment(s)
PositionSequence
62-76KHLKDEAKRKKNAAK
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004413  Apn/Gln-ADT_bsu  
IPR017959  Asn/Gln-tRNA_amidoTrfase_suB/E  
IPR006075  Asn/Gln-tRNA_Trfase_suB/E_cat  
IPR018027  Asn/Gln_amidotransferase  
IPR003789  Asn/Gln_tRNA_amidoTrase-B-like  
IPR023168  GatB_Yqey_C_2  
IPR017958  Gln-tRNA_amidoTrfase_suB_CS  
IPR014746  Gln_synth/guanido_kin_cat_dom  
Gene Ontology GO:0030956  C:glutamyl-tRNA(Gln) amidotransferase complex  
GO:0005739  C:mitochondrion  
GO:0005524  F:ATP binding  
GO:0050567  F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity  
GO:0070681  P:glutaminyl-tRNAGln biosynthesis via transamidation  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF02934  GatB_N  
PF02637  GatB_Yqey  
PROSITE View protein in PROSITE  
PS01234  GATB  
Amino Acid Sequences MSVATARQAPLTLVRAYSASAAARLRRPRPCILANWPRWLNARHVTTTTAPLSQEEAVPLRKHLKDEAKRKKNAAKANNAGATRKQQIDPRLEQWELTVGIEIHAELNTAQKLFSPATTEASGTAPNCRVALFDAATPGAQPQFQVATLLPALRAAIALDCEVQHKSGWDRKHYFHWDQPNGYQITQYYHPFAKNGSVSLTAADGVPAEELQGAEAVRVGIKQIQMEQDTAKTTNIGSSTYHVDLNRAGLPLIEIITLPQIHSPQTAAAVVRKIAGVLRSVDACVTGMEFGGLRADVNVSVRRRGTEGSGVNYSGVSGLGQRTEIKNLSSFKAVEDAIIAERDRQISVLEAGGTIEGETRGWTLGASETARLRGKEGEVDYRYMPDPDLPPLIIASGLVDHLRSRMPELPDETVQRVQVQYGLSAKDAKTISDLDDGDRLDFMGETVLLVKAASGNNSIDEQKIGKLVGNWMLHELGGLLTTSETSWDSMSITPQELADIITNVQHKHITARVGKQLLATLHDEDPNHPRPTVEQIIDEGNLRLRPLTEEGYEQLAQAIMDENPEMVNAVRVKGQKGKAMWFVGQMVRRGDEGTVEPEKAKEVVEKLLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.2
5 0.17
6 0.14
7 0.16
8 0.2
9 0.24
10 0.31
11 0.39
12 0.46
13 0.51
14 0.57
15 0.6
16 0.64
17 0.65
18 0.64
19 0.66
20 0.69
21 0.67
22 0.71
23 0.65
24 0.6
25 0.6
26 0.55
27 0.52
28 0.49
29 0.49
30 0.43
31 0.43
32 0.44
33 0.41
34 0.45
35 0.4
36 0.33
37 0.28
38 0.26
39 0.27
40 0.24
41 0.22
42 0.19
43 0.21
44 0.23
45 0.24
46 0.27
47 0.31
48 0.32
49 0.34
50 0.4
51 0.47
52 0.52
53 0.62
54 0.7
55 0.72
56 0.77
57 0.82
58 0.82
59 0.79
60 0.8
61 0.78
62 0.77
63 0.74
64 0.75
65 0.73
66 0.67
67 0.61
68 0.55
69 0.52
70 0.47
71 0.44
72 0.39
73 0.39
74 0.45
75 0.5
76 0.51
77 0.5
78 0.51
79 0.47
80 0.44
81 0.39
82 0.35
83 0.28
84 0.22
85 0.19
86 0.13
87 0.13
88 0.13
89 0.12
90 0.09
91 0.08
92 0.08
93 0.06
94 0.1
95 0.11
96 0.11
97 0.1
98 0.11
99 0.14
100 0.14
101 0.15
102 0.16
103 0.16
104 0.2
105 0.21
106 0.2
107 0.18
108 0.19
109 0.2
110 0.16
111 0.19
112 0.17
113 0.17
114 0.17
115 0.16
116 0.15
117 0.15
118 0.18
119 0.15
120 0.14
121 0.14
122 0.15
123 0.14
124 0.14
125 0.13
126 0.1
127 0.09
128 0.08
129 0.08
130 0.09
131 0.1
132 0.11
133 0.1
134 0.11
135 0.12
136 0.12
137 0.11
138 0.09
139 0.09
140 0.08
141 0.08
142 0.05
143 0.05
144 0.06
145 0.06
146 0.07
147 0.07
148 0.09
149 0.09
150 0.1
151 0.09
152 0.11
153 0.16
154 0.21
155 0.26
156 0.33
157 0.38
158 0.4
159 0.49
160 0.55
161 0.55
162 0.56
163 0.62
164 0.59
165 0.57
166 0.55
167 0.52
168 0.46
169 0.41
170 0.35
171 0.25
172 0.23
173 0.23
174 0.23
175 0.2
176 0.21
177 0.21
178 0.21
179 0.21
180 0.22
181 0.2
182 0.19
183 0.17
184 0.16
185 0.15
186 0.15
187 0.15
188 0.1
189 0.09
190 0.08
191 0.06
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.07
208 0.08
209 0.09
210 0.1
211 0.14
212 0.15
213 0.16
214 0.16
215 0.15
216 0.16
217 0.17
218 0.15
219 0.12
220 0.11
221 0.12
222 0.11
223 0.11
224 0.09
225 0.1
226 0.14
227 0.15
228 0.17
229 0.15
230 0.15
231 0.15
232 0.16
233 0.16
234 0.13
235 0.11
236 0.09
237 0.09
238 0.09
239 0.09
240 0.06
241 0.05
242 0.05
243 0.06
244 0.06
245 0.06
246 0.07
247 0.07
248 0.08
249 0.08
250 0.08
251 0.07
252 0.08
253 0.09
254 0.08
255 0.09
256 0.1
257 0.09
258 0.09
259 0.09
260 0.08
261 0.08
262 0.09
263 0.08
264 0.08
265 0.09
266 0.09
267 0.09
268 0.09
269 0.08
270 0.07
271 0.06
272 0.05
273 0.04
274 0.04
275 0.04
276 0.04
277 0.03
278 0.04
279 0.04
280 0.03
281 0.03
282 0.04
283 0.04
284 0.06
285 0.11
286 0.11
287 0.14
288 0.14
289 0.15
290 0.16
291 0.16
292 0.16
293 0.18
294 0.19
295 0.19
296 0.2
297 0.19
298 0.18
299 0.17
300 0.15
301 0.09
302 0.07
303 0.04
304 0.04
305 0.04
306 0.05
307 0.05
308 0.07
309 0.08
310 0.1
311 0.11
312 0.11
313 0.15
314 0.16
315 0.17
316 0.18
317 0.17
318 0.15
319 0.17
320 0.16
321 0.12
322 0.1
323 0.1
324 0.08
325 0.09
326 0.09
327 0.07
328 0.08
329 0.09
330 0.08
331 0.08
332 0.08
333 0.07
334 0.08
335 0.08
336 0.07
337 0.06
338 0.06
339 0.06
340 0.05
341 0.04
342 0.04
343 0.04
344 0.04
345 0.04
346 0.04
347 0.04
348 0.05
349 0.04
350 0.05
351 0.05
352 0.07
353 0.07
354 0.09
355 0.09
356 0.13
357 0.15
358 0.15
359 0.16
360 0.16
361 0.16
362 0.19
363 0.21
364 0.25
365 0.24
366 0.26
367 0.25
368 0.25
369 0.25
370 0.21
371 0.19
372 0.14
373 0.14
374 0.14
375 0.15
376 0.13
377 0.12
378 0.12
379 0.12
380 0.09
381 0.07
382 0.05
383 0.04
384 0.05
385 0.04
386 0.05
387 0.05
388 0.06
389 0.07
390 0.07
391 0.11
392 0.16
393 0.18
394 0.21
395 0.24
396 0.26
397 0.28
398 0.3
399 0.3
400 0.26
401 0.25
402 0.23
403 0.2
404 0.17
405 0.17
406 0.14
407 0.13
408 0.14
409 0.14
410 0.14
411 0.17
412 0.16
413 0.19
414 0.19
415 0.18
416 0.17
417 0.17
418 0.19
419 0.2
420 0.21
421 0.16
422 0.19
423 0.19
424 0.17
425 0.16
426 0.14
427 0.09
428 0.09
429 0.08
430 0.05
431 0.05
432 0.04
433 0.05
434 0.05
435 0.05
436 0.05
437 0.05
438 0.07
439 0.08
440 0.09
441 0.1
442 0.1
443 0.11
444 0.13
445 0.14
446 0.12
447 0.13
448 0.13
449 0.12
450 0.13
451 0.12
452 0.12
453 0.12
454 0.15
455 0.21
456 0.21
457 0.2
458 0.21
459 0.21
460 0.19
461 0.17
462 0.15
463 0.07
464 0.07
465 0.06
466 0.05
467 0.04
468 0.05
469 0.05
470 0.06
471 0.06
472 0.07
473 0.07
474 0.07
475 0.09
476 0.1
477 0.12
478 0.13
479 0.14
480 0.13
481 0.13
482 0.13
483 0.12
484 0.12
485 0.11
486 0.1
487 0.09
488 0.12
489 0.14
490 0.14
491 0.16
492 0.16
493 0.15
494 0.18
495 0.22
496 0.25
497 0.29
498 0.35
499 0.41
500 0.41
501 0.42
502 0.39
503 0.39
504 0.33
505 0.3
506 0.27
507 0.23
508 0.23
509 0.25
510 0.25
511 0.24
512 0.31
513 0.34
514 0.34
515 0.31
516 0.29
517 0.29
518 0.36
519 0.4
520 0.34
521 0.29
522 0.28
523 0.31
524 0.31
525 0.3
526 0.22
527 0.19
528 0.18
529 0.17
530 0.16
531 0.14
532 0.17
533 0.19
534 0.22
535 0.2
536 0.22
537 0.23
538 0.28
539 0.27
540 0.24
541 0.2
542 0.17
543 0.15
544 0.13
545 0.13
546 0.08
547 0.09
548 0.09
549 0.08
550 0.08
551 0.08
552 0.08
553 0.07
554 0.12
555 0.12
556 0.13
557 0.19
558 0.21
559 0.25
560 0.33
561 0.37
562 0.38
563 0.41
564 0.46
565 0.48
566 0.49
567 0.47
568 0.41
569 0.41
570 0.41
571 0.41
572 0.39
573 0.35
574 0.32
575 0.31
576 0.3
577 0.25
578 0.23
579 0.21
580 0.24
581 0.24
582 0.24
583 0.25
584 0.24
585 0.26
586 0.24
587 0.23
588 0.21
589 0.2
590 0.24