Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6ZWA4

Protein Details
Accession A0A3M6ZWA4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MANKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEGQVTLRTRKFIRNPLLGRKQMVVDVLHPSRPNVSKDELRTKLSELYKSGKDQVSVFGFRTHYGGGKSTGFALIYDSNEAMKSFEPHYRLVRYGMANKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.65
4 0.71
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.21
14 0.25
15 0.24
16 0.25
17 0.24
18 0.23
19 0.26
20 0.29
21 0.3
22 0.26
23 0.3
24 0.32
25 0.38
26 0.47
27 0.45
28 0.44
29 0.43
30 0.41
31 0.42
32 0.4
33 0.36
34 0.29
35 0.3
36 0.3
37 0.31
38 0.34
39 0.28
40 0.26
41 0.24
42 0.25
43 0.24
44 0.22
45 0.21
46 0.19
47 0.18
48 0.18
49 0.18
50 0.14
51 0.12
52 0.12
53 0.12
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.09
60 0.08
61 0.09
62 0.08
63 0.08
64 0.09
65 0.09
66 0.08
67 0.09
68 0.09
69 0.08
70 0.07
71 0.09
72 0.1
73 0.14
74 0.16
75 0.19
76 0.23
77 0.24
78 0.25
79 0.25
80 0.27
81 0.27
82 0.3
83 0.32
84 0.34
85 0.33
86 0.33
87 0.34
88 0.32
89 0.31
90 0.34
91 0.4
92 0.44
93 0.52
94 0.62
95 0.69
96 0.79
97 0.88
98 0.9
99 0.91
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63