Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6Y086

Protein Details
Accession A0A3M6Y086    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-76HVTRRMSKGRQTKRSKVKPFIKVVNYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKVGRVAIISRGRYAGKKVVIVQPQDNGSKKHPFPHAIVAGIDRYPLHVTRRMSKGRQTKRSKVKPFIKVVNYNHIMPTRYTLELEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.33
5 0.32
6 0.28
7 0.29
8 0.32
9 0.36
10 0.39
11 0.41
12 0.38
13 0.35
14 0.35
15 0.37
16 0.36
17 0.31
18 0.3
19 0.35
20 0.34
21 0.37
22 0.38
23 0.36
24 0.36
25 0.41
26 0.38
27 0.31
28 0.3
29 0.25
30 0.21
31 0.18
32 0.15
33 0.08
34 0.08
35 0.08
36 0.1
37 0.11
38 0.16
39 0.18
40 0.24
41 0.32
42 0.36
43 0.38
44 0.45
45 0.53
46 0.58
47 0.66
48 0.69
49 0.72
50 0.77
51 0.85
52 0.86
53 0.86
54 0.85
55 0.84
56 0.82
57 0.81
58 0.78
59 0.76
60 0.71
61 0.71
62 0.64
63 0.56
64 0.53
65 0.47
66 0.41
67 0.33
68 0.34
69 0.28
70 0.26
71 0.26