Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6ZKH8

Protein Details
Accession A0A3M6ZKH8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
154-185RTVTTGRHKKEIKRRTKTGCLTCRKRRIKVSKBasic
NLS Segment(s)
PositionSequence
161-169HKKEIKRRT
178-182KRRIK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 3.5, mito 1, plas 1, extr 1, pero 1
Family & Domain DBs
Amino Acid Sequences MDGLVNWEAASPAADTATTTAAAAAAPPTLAQTRKASEDMENGQQQQQPPPPHSQQHQHQQYHYGPTASQQPSRASPNGQNSMQSPSLLPPIHQGGLPAQPQYGAHPAAYVPAPPYAAYQNGGMQPMPMPPNVAPNGQNGMMRYPIPQVPVDSRTVTTGRHKKEIKRRTKTGCLTCRKRRIKVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.08
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.07
16 0.1
17 0.12
18 0.15
19 0.18
20 0.21
21 0.25
22 0.26
23 0.26
24 0.25
25 0.3
26 0.3
27 0.32
28 0.32
29 0.3
30 0.32
31 0.33
32 0.31
33 0.32
34 0.35
35 0.33
36 0.34
37 0.39
38 0.41
39 0.44
40 0.47
41 0.49
42 0.5
43 0.57
44 0.63
45 0.59
46 0.55
47 0.56
48 0.54
49 0.51
50 0.45
51 0.35
52 0.25
53 0.24
54 0.32
55 0.28
56 0.27
57 0.24
58 0.25
59 0.27
60 0.32
61 0.31
62 0.25
63 0.28
64 0.33
65 0.36
66 0.33
67 0.32
68 0.29
69 0.32
70 0.29
71 0.24
72 0.17
73 0.13
74 0.17
75 0.16
76 0.15
77 0.12
78 0.14
79 0.14
80 0.14
81 0.13
82 0.1
83 0.14
84 0.15
85 0.13
86 0.11
87 0.11
88 0.11
89 0.13
90 0.14
91 0.1
92 0.1
93 0.1
94 0.1
95 0.11
96 0.11
97 0.09
98 0.07
99 0.07
100 0.08
101 0.08
102 0.09
103 0.09
104 0.1
105 0.11
106 0.11
107 0.13
108 0.13
109 0.14
110 0.12
111 0.11
112 0.11
113 0.13
114 0.14
115 0.11
116 0.12
117 0.12
118 0.18
119 0.2
120 0.21
121 0.19
122 0.2
123 0.23
124 0.22
125 0.23
126 0.18
127 0.18
128 0.18
129 0.17
130 0.16
131 0.16
132 0.17
133 0.18
134 0.18
135 0.19
136 0.22
137 0.25
138 0.26
139 0.25
140 0.24
141 0.25
142 0.25
143 0.25
144 0.32
145 0.38
146 0.4
147 0.47
148 0.53
149 0.59
150 0.69
151 0.76
152 0.77
153 0.78
154 0.83
155 0.82
156 0.87
157 0.87
158 0.87
159 0.86
160 0.86
161 0.87
162 0.88
163 0.9
164 0.88
165 0.87