Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VYD4

Protein Details
Accession K1VYD4   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
141-162DEPPKPKRSKATPKASKGRSKKBasic
NLS Segment(s)
PositionSequence
144-162PKPKRSKATPKASKGRSKK
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037647  HIRIP3  
Amino Acid Sequences MDAKLAKKLPAAAKSVVSEAMRSGAFDKGELTMGEARRLVALKMGLEEDALDSAKDIRKQVKEAITEAIDEDASDEPESPVKVRKGEPKRVSDVQSSATSTPAKPAKKTTSKKTVESDEEDEAEVAAPPSPASSAMSSVYDEPPKPKRSKATPKASKGRSKKDTNEGTRDQIRHVQDILRDLGMKGNPTLGKAKSLKARRELAQELSDVREYEQGHGLSADRPSRTRAGRGTRDSAPPAPDEDGATAAVMDFLGDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.35
4 0.29
5 0.24
6 0.19
7 0.2
8 0.16
9 0.16
10 0.16
11 0.15
12 0.15
13 0.14
14 0.15
15 0.13
16 0.15
17 0.13
18 0.15
19 0.18
20 0.19
21 0.21
22 0.2
23 0.19
24 0.2
25 0.21
26 0.17
27 0.15
28 0.15
29 0.14
30 0.15
31 0.15
32 0.13
33 0.12
34 0.12
35 0.09
36 0.09
37 0.08
38 0.07
39 0.06
40 0.1
41 0.14
42 0.16
43 0.19
44 0.25
45 0.28
46 0.31
47 0.38
48 0.41
49 0.39
50 0.38
51 0.39
52 0.32
53 0.29
54 0.26
55 0.2
56 0.14
57 0.11
58 0.11
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.1
66 0.1
67 0.15
68 0.17
69 0.2
70 0.23
71 0.33
72 0.41
73 0.51
74 0.57
75 0.57
76 0.61
77 0.63
78 0.62
79 0.55
80 0.48
81 0.41
82 0.35
83 0.32
84 0.25
85 0.23
86 0.2
87 0.17
88 0.21
89 0.23
90 0.24
91 0.23
92 0.29
93 0.36
94 0.45
95 0.52
96 0.54
97 0.59
98 0.61
99 0.64
100 0.62
101 0.58
102 0.52
103 0.5
104 0.44
105 0.35
106 0.31
107 0.27
108 0.23
109 0.17
110 0.13
111 0.09
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.07
123 0.08
124 0.08
125 0.1
126 0.11
127 0.12
128 0.12
129 0.16
130 0.22
131 0.28
132 0.3
133 0.32
134 0.38
135 0.46
136 0.57
137 0.63
138 0.67
139 0.71
140 0.77
141 0.83
142 0.82
143 0.81
144 0.78
145 0.79
146 0.76
147 0.73
148 0.7
149 0.71
150 0.73
151 0.7
152 0.69
153 0.62
154 0.59
155 0.58
156 0.53
157 0.45
158 0.42
159 0.38
160 0.32
161 0.31
162 0.28
163 0.23
164 0.26
165 0.24
166 0.19
167 0.17
168 0.15
169 0.18
170 0.16
171 0.16
172 0.13
173 0.16
174 0.16
175 0.18
176 0.22
177 0.19
178 0.25
179 0.26
180 0.31
181 0.35
182 0.43
183 0.47
184 0.49
185 0.55
186 0.51
187 0.57
188 0.55
189 0.51
190 0.45
191 0.4
192 0.35
193 0.33
194 0.3
195 0.23
196 0.2
197 0.2
198 0.19
199 0.2
200 0.24
201 0.21
202 0.2
203 0.2
204 0.2
205 0.18
206 0.22
207 0.24
208 0.2
209 0.22
210 0.25
211 0.32
212 0.34
213 0.38
214 0.42
215 0.48
216 0.55
217 0.6
218 0.62
219 0.6
220 0.62
221 0.61
222 0.57
223 0.49
224 0.42
225 0.38
226 0.35
227 0.31
228 0.27
229 0.23
230 0.2
231 0.17
232 0.16
233 0.12
234 0.09
235 0.08
236 0.07
237 0.05
238 0.04