Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VG53

Protein Details
Accession K1VG53    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
218-242FPLSPCVCKKEKKKSIVKKELGIKSHydrophilic
NLS Segment(s)
PositionSequence
227-236KEKKKSIVKK
Subcellular Location(s) cyto 12, cyto_mito 11.833, mito 10.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MSKLKQDSASVPISRDVTLIPAVGGARIMVNRTQLYAASAGEANWTSPNTIQFTDPAFESGEVLRYIASLVSNGEIGPEGDVFDDNKQVVPAVVKFLRRWDCPRFLAVICQRTAEAHAGAEIRDSQAFVIGALAEDVRLCQQAVAHRHEPLEVSHIPIEFWPHIKPEYLFALATIKAGKERIRCDELCDARTWRALVELGADGLRYFAESCEMGKAPFPLSPCVCKKEKKKSIVKKELGIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.21
4 0.17
5 0.17
6 0.15
7 0.11
8 0.11
9 0.11
10 0.1
11 0.1
12 0.07
13 0.08
14 0.08
15 0.1
16 0.11
17 0.14
18 0.15
19 0.16
20 0.17
21 0.15
22 0.16
23 0.16
24 0.14
25 0.12
26 0.12
27 0.11
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.15
36 0.16
37 0.17
38 0.17
39 0.17
40 0.19
41 0.19
42 0.18
43 0.16
44 0.14
45 0.13
46 0.13
47 0.12
48 0.12
49 0.11
50 0.1
51 0.09
52 0.08
53 0.08
54 0.07
55 0.07
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.07
70 0.07
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.12
80 0.14
81 0.16
82 0.16
83 0.23
84 0.28
85 0.3
86 0.35
87 0.36
88 0.39
89 0.39
90 0.4
91 0.36
92 0.31
93 0.35
94 0.35
95 0.33
96 0.27
97 0.26
98 0.25
99 0.22
100 0.23
101 0.17
102 0.12
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.03
122 0.03
123 0.03
124 0.04
125 0.04
126 0.04
127 0.04
128 0.06
129 0.12
130 0.17
131 0.23
132 0.24
133 0.25
134 0.25
135 0.25
136 0.24
137 0.19
138 0.2
139 0.14
140 0.15
141 0.15
142 0.15
143 0.15
144 0.14
145 0.17
146 0.13
147 0.14
148 0.13
149 0.13
150 0.14
151 0.16
152 0.16
153 0.15
154 0.18
155 0.18
156 0.16
157 0.15
158 0.16
159 0.15
160 0.15
161 0.13
162 0.1
163 0.1
164 0.13
165 0.16
166 0.19
167 0.24
168 0.3
169 0.35
170 0.35
171 0.39
172 0.46
173 0.46
174 0.43
175 0.42
176 0.38
177 0.34
178 0.36
179 0.31
180 0.22
181 0.19
182 0.18
183 0.15
184 0.14
185 0.12
186 0.11
187 0.11
188 0.1
189 0.08
190 0.08
191 0.08
192 0.06
193 0.06
194 0.05
195 0.08
196 0.09
197 0.1
198 0.14
199 0.15
200 0.14
201 0.16
202 0.17
203 0.16
204 0.18
205 0.19
206 0.22
207 0.25
208 0.33
209 0.36
210 0.41
211 0.46
212 0.53
213 0.61
214 0.66
215 0.72
216 0.74
217 0.8
218 0.84
219 0.9
220 0.92
221 0.88
222 0.85