Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7EZA8

Protein Details
Accession A0A3M7EZA8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVBasic
NLS Segment(s)
PositionSequence
3-24KKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRECPNETCGAGIFMAAMHNRQYCGRCHLTYVFDDPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.94
5 0.94
6 0.94
7 0.94
8 0.95
9 0.94
10 0.94
11 0.93
12 0.91
13 0.9
14 0.85
15 0.79
16 0.7
17 0.61
18 0.5
19 0.42
20 0.34
21 0.24
22 0.23
23 0.2
24 0.21
25 0.24
26 0.26
27 0.26
28 0.27
29 0.31
30 0.31
31 0.36
32 0.39
33 0.38
34 0.4
35 0.4
36 0.37
37 0.34
38 0.28
39 0.21
40 0.15
41 0.11
42 0.07
43 0.06
44 0.07
45 0.07
46 0.08
47 0.1
48 0.11
49 0.12
50 0.16
51 0.18
52 0.2
53 0.27
54 0.33
55 0.3
56 0.34
57 0.37
58 0.37
59 0.38