Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7A2R3

Protein Details
Accession A0A3M7A2R3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-36LPFLEPDKKQRYKQGLNQLWQQYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR037794  TAF12  
IPR003228  TFIID_TAF12_dom  
Gene Ontology GO:0000124  C:SAGA complex  
GO:0046695  C:SLIK (SAGA-like) complex  
GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03847  TFIID_20kDa  
CDD cd07981  TAF12  
Amino Acid Sequences MSQMLIKPEQIDNLPFLEPDKKQRYKQGLNQLWQQYDGGQVGTPQRQQAEEKIRSVSRKLMEEMAAHQRQKNGPQQGQPNQPTQQPAGQNGQMQRPPTAGGMGGGAGAGSAGGVPQANNMQQGAPPQQQQPTGGQSQMVPWIQREVSSVNIHIPHNIQPAQASAYRQKWLQHAITELQKKESANSIGKQLQPTIKDHQQKGTQAPPEVMQKWEAAKRTVQEVDARWNRMKADNEAKGRANQQAAQQQQQQQQSGGGGAGGAGGGQQMPNQQMPNQQGLNGSEMQRSMSGQQQGGQMKQGQAPTSNSPAQAQPNFQQPQPPAVNQPAPSAPTPGMNPQQQPQGVSTPQPPPAQTPQTATQSHPPPPNFPQQQVPQSQQQIPQQPQQQQPQHQYGQQPQRPPFNQQHVSQQQVQQTPGGQPQPMVNRANSAGPQQPGQQRPQALSQQAAVAQAAQAYQNQQAIHQQQAQQGMAPNQQQGPPGVAPQQPGQPQHPGQQMVGGGGPGPQYPGGPQQQGQPTPTSAGGFGVPPGHTQHQPPSMQATTTPNNKFPIPKQLHINSQINQQVQGPPSRPTMANAGMVSQPGLQRPAAYTLEGEGDRVLSKRKLDELVRQVTGGGSTSSSTTDPEHAFLDPLVEENVLALADDFVDSVITSACKLAKLRPNQMLELRDVQMVLERNWGIRVPGYTLEEVRAVKRFQPTVEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.22
4 0.25
5 0.26
6 0.34
7 0.43
8 0.48
9 0.52
10 0.62
11 0.7
12 0.73
13 0.79
14 0.8
15 0.79
16 0.77
17 0.81
18 0.77
19 0.68
20 0.6
21 0.51
22 0.4
23 0.35
24 0.29
25 0.21
26 0.14
27 0.16
28 0.21
29 0.26
30 0.27
31 0.27
32 0.28
33 0.3
34 0.33
35 0.39
36 0.44
37 0.44
38 0.45
39 0.48
40 0.51
41 0.52
42 0.52
43 0.5
44 0.45
45 0.44
46 0.44
47 0.42
48 0.4
49 0.37
50 0.39
51 0.42
52 0.43
53 0.41
54 0.41
55 0.43
56 0.44
57 0.51
58 0.54
59 0.54
60 0.54
61 0.59
62 0.66
63 0.69
64 0.75
65 0.71
66 0.69
67 0.62
68 0.59
69 0.55
70 0.49
71 0.46
72 0.4
73 0.4
74 0.4
75 0.39
76 0.41
77 0.41
78 0.45
79 0.42
80 0.4
81 0.37
82 0.32
83 0.3
84 0.26
85 0.23
86 0.15
87 0.13
88 0.11
89 0.1
90 0.09
91 0.07
92 0.06
93 0.04
94 0.04
95 0.03
96 0.02
97 0.02
98 0.02
99 0.03
100 0.03
101 0.04
102 0.06
103 0.09
104 0.1
105 0.11
106 0.12
107 0.12
108 0.13
109 0.18
110 0.22
111 0.23
112 0.26
113 0.29
114 0.32
115 0.33
116 0.34
117 0.34
118 0.33
119 0.31
120 0.28
121 0.25
122 0.22
123 0.22
124 0.25
125 0.23
126 0.19
127 0.17
128 0.21
129 0.2
130 0.2
131 0.21
132 0.17
133 0.2
134 0.21
135 0.21
136 0.2
137 0.24
138 0.23
139 0.23
140 0.24
141 0.23
142 0.27
143 0.27
144 0.24
145 0.21
146 0.22
147 0.23
148 0.24
149 0.23
150 0.24
151 0.26
152 0.28
153 0.3
154 0.31
155 0.32
156 0.37
157 0.36
158 0.31
159 0.31
160 0.33
161 0.39
162 0.42
163 0.39
164 0.35
165 0.35
166 0.33
167 0.32
168 0.33
169 0.31
170 0.29
171 0.3
172 0.33
173 0.35
174 0.37
175 0.37
176 0.35
177 0.34
178 0.31
179 0.34
180 0.35
181 0.38
182 0.44
183 0.45
184 0.48
185 0.49
186 0.51
187 0.52
188 0.52
189 0.48
190 0.41
191 0.4
192 0.36
193 0.37
194 0.34
195 0.3
196 0.24
197 0.22
198 0.25
199 0.28
200 0.27
201 0.23
202 0.24
203 0.24
204 0.28
205 0.27
206 0.25
207 0.25
208 0.25
209 0.33
210 0.35
211 0.38
212 0.35
213 0.35
214 0.35
215 0.36
216 0.37
217 0.34
218 0.38
219 0.41
220 0.44
221 0.46
222 0.46
223 0.43
224 0.42
225 0.4
226 0.33
227 0.28
228 0.29
229 0.32
230 0.33
231 0.35
232 0.38
233 0.4
234 0.44
235 0.46
236 0.41
237 0.34
238 0.32
239 0.28
240 0.23
241 0.17
242 0.1
243 0.06
244 0.05
245 0.04
246 0.03
247 0.03
248 0.02
249 0.02
250 0.02
251 0.03
252 0.03
253 0.05
254 0.07
255 0.09
256 0.1
257 0.11
258 0.16
259 0.19
260 0.23
261 0.21
262 0.21
263 0.21
264 0.21
265 0.22
266 0.2
267 0.18
268 0.15
269 0.15
270 0.14
271 0.13
272 0.12
273 0.11
274 0.13
275 0.15
276 0.14
277 0.17
278 0.22
279 0.23
280 0.23
281 0.23
282 0.21
283 0.2
284 0.22
285 0.21
286 0.16
287 0.17
288 0.19
289 0.2
290 0.23
291 0.22
292 0.2
293 0.2
294 0.22
295 0.24
296 0.23
297 0.23
298 0.2
299 0.28
300 0.29
301 0.28
302 0.3
303 0.26
304 0.32
305 0.31
306 0.3
307 0.24
308 0.26
309 0.29
310 0.25
311 0.26
312 0.2
313 0.2
314 0.19
315 0.18
316 0.15
317 0.13
318 0.14
319 0.16
320 0.19
321 0.2
322 0.21
323 0.21
324 0.25
325 0.25
326 0.24
327 0.22
328 0.2
329 0.18
330 0.19
331 0.21
332 0.19
333 0.23
334 0.23
335 0.22
336 0.23
337 0.27
338 0.29
339 0.26
340 0.27
341 0.26
342 0.31
343 0.32
344 0.29
345 0.31
346 0.32
347 0.36
348 0.38
349 0.34
350 0.33
351 0.36
352 0.44
353 0.39
354 0.37
355 0.38
356 0.37
357 0.42
358 0.41
359 0.4
360 0.36
361 0.38
362 0.38
363 0.36
364 0.37
365 0.38
366 0.38
367 0.4
368 0.41
369 0.44
370 0.47
371 0.51
372 0.52
373 0.51
374 0.53
375 0.54
376 0.5
377 0.47
378 0.45
379 0.45
380 0.49
381 0.47
382 0.48
383 0.45
384 0.51
385 0.5
386 0.52
387 0.5
388 0.49
389 0.51
390 0.46
391 0.53
392 0.48
393 0.51
394 0.48
395 0.45
396 0.41
397 0.38
398 0.38
399 0.28
400 0.25
401 0.23
402 0.24
403 0.21
404 0.16
405 0.15
406 0.18
407 0.21
408 0.25
409 0.25
410 0.21
411 0.21
412 0.22
413 0.23
414 0.2
415 0.19
416 0.18
417 0.17
418 0.18
419 0.22
420 0.27
421 0.29
422 0.32
423 0.33
424 0.3
425 0.31
426 0.35
427 0.34
428 0.29
429 0.26
430 0.24
431 0.21
432 0.2
433 0.19
434 0.14
435 0.09
436 0.08
437 0.07
438 0.07
439 0.06
440 0.06
441 0.07
442 0.09
443 0.12
444 0.12
445 0.12
446 0.17
447 0.19
448 0.22
449 0.24
450 0.26
451 0.26
452 0.29
453 0.29
454 0.25
455 0.25
456 0.24
457 0.24
458 0.22
459 0.21
460 0.2
461 0.21
462 0.21
463 0.19
464 0.2
465 0.16
466 0.16
467 0.19
468 0.19
469 0.19
470 0.2
471 0.25
472 0.25
473 0.28
474 0.29
475 0.31
476 0.32
477 0.36
478 0.39
479 0.35
480 0.32
481 0.31
482 0.29
483 0.23
484 0.21
485 0.14
486 0.09
487 0.09
488 0.09
489 0.07
490 0.07
491 0.07
492 0.07
493 0.08
494 0.15
495 0.18
496 0.19
497 0.2
498 0.26
499 0.32
500 0.34
501 0.35
502 0.31
503 0.28
504 0.28
505 0.28
506 0.22
507 0.15
508 0.14
509 0.12
510 0.1
511 0.1
512 0.11
513 0.1
514 0.11
515 0.14
516 0.17
517 0.18
518 0.21
519 0.26
520 0.31
521 0.32
522 0.32
523 0.34
524 0.32
525 0.3
526 0.3
527 0.3
528 0.29
529 0.37
530 0.39
531 0.36
532 0.38
533 0.4
534 0.42
535 0.38
536 0.43
537 0.42
538 0.43
539 0.48
540 0.5
541 0.55
542 0.59
543 0.61
544 0.52
545 0.52
546 0.53
547 0.45
548 0.42
549 0.36
550 0.33
551 0.3
552 0.33
553 0.28
554 0.26
555 0.29
556 0.31
557 0.29
558 0.27
559 0.3
560 0.28
561 0.29
562 0.26
563 0.25
564 0.22
565 0.22
566 0.21
567 0.17
568 0.16
569 0.14
570 0.16
571 0.14
572 0.14
573 0.16
574 0.2
575 0.19
576 0.18
577 0.17
578 0.16
579 0.2
580 0.19
581 0.18
582 0.12
583 0.12
584 0.13
585 0.14
586 0.18
587 0.17
588 0.2
589 0.23
590 0.27
591 0.32
592 0.35
593 0.44
594 0.48
595 0.51
596 0.49
597 0.46
598 0.42
599 0.36
600 0.32
601 0.23
602 0.15
603 0.09
604 0.09
605 0.09
606 0.11
607 0.11
608 0.12
609 0.13
610 0.17
611 0.18
612 0.19
613 0.2
614 0.18
615 0.19
616 0.17
617 0.17
618 0.12
619 0.12
620 0.11
621 0.1
622 0.09
623 0.08
624 0.09
625 0.07
626 0.06
627 0.05
628 0.04
629 0.05
630 0.05
631 0.05
632 0.04
633 0.05
634 0.05
635 0.05
636 0.06
637 0.06
638 0.06
639 0.09
640 0.1
641 0.13
642 0.15
643 0.23
644 0.31
645 0.4
646 0.48
647 0.54
648 0.58
649 0.6
650 0.65
651 0.6
652 0.56
653 0.52
654 0.45
655 0.37
656 0.33
657 0.27
658 0.26
659 0.26
660 0.22
661 0.23
662 0.22
663 0.22
664 0.24
665 0.25
666 0.21
667 0.21
668 0.22
669 0.19
670 0.23
671 0.26
672 0.27
673 0.28
674 0.28
675 0.29
676 0.29
677 0.29
678 0.29
679 0.28
680 0.3
681 0.37
682 0.38