Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6XRE6

Protein Details
Accession A0A3M6XRE6    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
410-429GIQPCRRPLRLKVRKEWINQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 6, vacu 3, nucl 2, cyto 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001708  YidC/ALB3/OXA1/COX18  
Gene Ontology GO:0016020  C:membrane  
GO:0032977  F:membrane insertase activity  
Amino Acid Sequences MATPLRARALRPSLFHLPPALRVSAFQATTAQRNFSSTSAPFSLVDLAVTPPSYLLDLLHTSLGLPWYAVLPATALVVRSSLLYFLSARNDRRKEGLRANLVPVATARVTRQLNSPEAERKRRRTAPFLRPFFEAANGWLTRRNEFRTLEKQFGISPFRGGWLVNFGVLIAVTEAVRMRCGSREGLLPLALHPFEKMREALNGKAPVPSPESAAAASGEGAAAARGLSEDQLRAAMVTDADGNVTVDFAQLQQFAQDLPPAPTAYSASFDPSLQLEGLPWCLDLTLPDSSFILPTSLVLIMAAGIVFKPGQSLSKPRSSPSAKPPVPTTAPASPSPTPQQPLPPPYRLLPPITNLQRLQLSILPPFWLVALQFPAAIVLYVASSSAITTLQKWWVYRKMMGGGGVGAAAGIQPCRRPLRLKVRKEWINQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.47
4 0.4
5 0.41
6 0.42
7 0.36
8 0.28
9 0.27
10 0.31
11 0.31
12 0.29
13 0.24
14 0.26
15 0.27
16 0.34
17 0.35
18 0.33
19 0.27
20 0.29
21 0.31
22 0.26
23 0.29
24 0.23
25 0.27
26 0.26
27 0.27
28 0.25
29 0.24
30 0.25
31 0.19
32 0.19
33 0.14
34 0.13
35 0.12
36 0.12
37 0.11
38 0.08
39 0.09
40 0.1
41 0.09
42 0.08
43 0.1
44 0.11
45 0.13
46 0.13
47 0.12
48 0.11
49 0.13
50 0.13
51 0.09
52 0.08
53 0.07
54 0.07
55 0.08
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.07
70 0.08
71 0.09
72 0.11
73 0.18
74 0.23
75 0.29
76 0.38
77 0.41
78 0.42
79 0.48
80 0.52
81 0.52
82 0.55
83 0.58
84 0.56
85 0.55
86 0.57
87 0.52
88 0.46
89 0.38
90 0.3
91 0.25
92 0.17
93 0.15
94 0.13
95 0.18
96 0.19
97 0.2
98 0.25
99 0.26
100 0.29
101 0.3
102 0.33
103 0.35
104 0.42
105 0.52
106 0.55
107 0.58
108 0.64
109 0.71
110 0.72
111 0.73
112 0.76
113 0.76
114 0.78
115 0.76
116 0.69
117 0.62
118 0.59
119 0.49
120 0.41
121 0.3
122 0.21
123 0.21
124 0.19
125 0.18
126 0.21
127 0.22
128 0.22
129 0.26
130 0.29
131 0.29
132 0.31
133 0.37
134 0.41
135 0.44
136 0.45
137 0.42
138 0.38
139 0.35
140 0.36
141 0.33
142 0.24
143 0.21
144 0.17
145 0.17
146 0.17
147 0.15
148 0.11
149 0.12
150 0.11
151 0.1
152 0.1
153 0.08
154 0.08
155 0.08
156 0.07
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.08
167 0.1
168 0.11
169 0.11
170 0.14
171 0.14
172 0.15
173 0.15
174 0.14
175 0.12
176 0.13
177 0.12
178 0.1
179 0.09
180 0.09
181 0.09
182 0.1
183 0.1
184 0.09
185 0.14
186 0.15
187 0.17
188 0.22
189 0.23
190 0.22
191 0.23
192 0.23
193 0.2
194 0.21
195 0.19
196 0.15
197 0.14
198 0.14
199 0.12
200 0.12
201 0.1
202 0.07
203 0.07
204 0.05
205 0.04
206 0.03
207 0.03
208 0.03
209 0.02
210 0.02
211 0.02
212 0.02
213 0.03
214 0.03
215 0.04
216 0.04
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.04
224 0.05
225 0.05
226 0.04
227 0.05
228 0.05
229 0.04
230 0.04
231 0.04
232 0.04
233 0.03
234 0.04
235 0.04
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.07
244 0.07
245 0.09
246 0.11
247 0.11
248 0.11
249 0.11
250 0.12
251 0.12
252 0.12
253 0.1
254 0.11
255 0.12
256 0.12
257 0.12
258 0.11
259 0.11
260 0.09
261 0.09
262 0.07
263 0.07
264 0.09
265 0.08
266 0.07
267 0.06
268 0.06
269 0.06
270 0.06
271 0.08
272 0.1
273 0.1
274 0.1
275 0.11
276 0.11
277 0.12
278 0.11
279 0.09
280 0.06
281 0.06
282 0.07
283 0.07
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.04
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.04
296 0.05
297 0.08
298 0.1
299 0.18
300 0.23
301 0.31
302 0.33
303 0.33
304 0.42
305 0.45
306 0.49
307 0.52
308 0.58
309 0.51
310 0.53
311 0.55
312 0.52
313 0.5
314 0.46
315 0.41
316 0.36
317 0.37
318 0.36
319 0.39
320 0.33
321 0.35
322 0.37
323 0.36
324 0.34
325 0.32
326 0.39
327 0.4
328 0.47
329 0.49
330 0.48
331 0.46
332 0.46
333 0.51
334 0.45
335 0.44
336 0.38
337 0.35
338 0.41
339 0.44
340 0.47
341 0.41
342 0.41
343 0.37
344 0.35
345 0.35
346 0.29
347 0.26
348 0.23
349 0.23
350 0.21
351 0.19
352 0.18
353 0.15
354 0.13
355 0.11
356 0.11
357 0.13
358 0.12
359 0.11
360 0.11
361 0.11
362 0.1
363 0.1
364 0.07
365 0.05
366 0.04
367 0.04
368 0.05
369 0.04
370 0.04
371 0.05
372 0.05
373 0.06
374 0.07
375 0.09
376 0.12
377 0.18
378 0.22
379 0.24
380 0.3
381 0.37
382 0.41
383 0.42
384 0.44
385 0.43
386 0.42
387 0.41
388 0.35
389 0.28
390 0.23
391 0.19
392 0.14
393 0.09
394 0.06
395 0.05
396 0.05
397 0.07
398 0.09
399 0.11
400 0.17
401 0.23
402 0.28
403 0.34
404 0.43
405 0.53
406 0.62
407 0.7
408 0.74
409 0.79