Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VLU3

Protein Details
Accession K1VLU3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-87DEGNEKPTRQKKKQGLSKGYDHydrophilic
NLS Segment(s)
PositionSequence
156-164ERRRRKKAR
193-193R
199-202QRRP
207-213GPGMKPP
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 7
Family & Domain DBs
Amino Acid Sequences MDIPKNGESSRPPTQGSAPGALILPEWDVLPQKHLHSSLDMISLLHLDGLYNTYVRPYFDPIPETDDEGNEKPTRQKKKQGLSKGYDPVPMGDQAGQSLLPLIGDFLDPPEPVAQLYEDALTALPAEAFRSARLEVGLKTEGYAGGEKVGVREAEERRRRKKARMSQSVAPDLPELANPGGAMPSPAPPRPGRPFTPGQRRPFGTPGPGMKPPFPRASAPPGYRPGTPGRPGTPGATPGTPGYAPHGVSHAPGTPNKRPGSEQPHGAVKRVKHGGGSRSASPADVGVRAVFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.45
4 0.41
5 0.33
6 0.3
7 0.28
8 0.25
9 0.21
10 0.14
11 0.11
12 0.08
13 0.08
14 0.08
15 0.12
16 0.13
17 0.16
18 0.18
19 0.2
20 0.24
21 0.26
22 0.26
23 0.24
24 0.27
25 0.25
26 0.24
27 0.22
28 0.17
29 0.16
30 0.15
31 0.12
32 0.1
33 0.08
34 0.05
35 0.05
36 0.07
37 0.07
38 0.07
39 0.07
40 0.09
41 0.1
42 0.12
43 0.14
44 0.18
45 0.22
46 0.24
47 0.27
48 0.25
49 0.3
50 0.29
51 0.31
52 0.26
53 0.23
54 0.24
55 0.23
56 0.27
57 0.22
58 0.23
59 0.27
60 0.36
61 0.45
62 0.47
63 0.56
64 0.61
65 0.7
66 0.78
67 0.81
68 0.81
69 0.77
70 0.78
71 0.74
72 0.66
73 0.58
74 0.49
75 0.4
76 0.32
77 0.26
78 0.2
79 0.15
80 0.13
81 0.1
82 0.1
83 0.09
84 0.07
85 0.07
86 0.06
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.06
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.06
103 0.07
104 0.06
105 0.05
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.04
114 0.05
115 0.06
116 0.06
117 0.08
118 0.08
119 0.08
120 0.09
121 0.1
122 0.09
123 0.12
124 0.12
125 0.1
126 0.1
127 0.1
128 0.1
129 0.09
130 0.09
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.06
138 0.07
139 0.12
140 0.15
141 0.25
142 0.33
143 0.41
144 0.46
145 0.57
146 0.6
147 0.63
148 0.7
149 0.7
150 0.73
151 0.76
152 0.75
153 0.71
154 0.73
155 0.69
156 0.58
157 0.49
158 0.38
159 0.28
160 0.22
161 0.16
162 0.12
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.09
172 0.12
173 0.13
174 0.17
175 0.18
176 0.25
177 0.31
178 0.36
179 0.35
180 0.39
181 0.46
182 0.51
183 0.62
184 0.63
185 0.62
186 0.63
187 0.63
188 0.61
189 0.58
190 0.51
191 0.44
192 0.41
193 0.39
194 0.37
195 0.4
196 0.38
197 0.38
198 0.41
199 0.42
200 0.41
201 0.39
202 0.37
203 0.36
204 0.42
205 0.46
206 0.43
207 0.45
208 0.47
209 0.46
210 0.44
211 0.43
212 0.41
213 0.4
214 0.41
215 0.39
216 0.36
217 0.37
218 0.38
219 0.37
220 0.33
221 0.29
222 0.28
223 0.24
224 0.23
225 0.19
226 0.21
227 0.18
228 0.16
229 0.18
230 0.18
231 0.19
232 0.18
233 0.2
234 0.17
235 0.18
236 0.2
237 0.19
238 0.19
239 0.23
240 0.3
241 0.35
242 0.43
243 0.44
244 0.45
245 0.45
246 0.51
247 0.56
248 0.54
249 0.53
250 0.49
251 0.57
252 0.55
253 0.56
254 0.52
255 0.44
256 0.48
257 0.48
258 0.44
259 0.41
260 0.46
261 0.47
262 0.51
263 0.53
264 0.46
265 0.45
266 0.44
267 0.38
268 0.33
269 0.29
270 0.22
271 0.18
272 0.17
273 0.14