Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R6J0

Protein Details
Accession C4R6J0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-100QLKVLGNKKNTKKWNPKRIPFPFDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037278  ARFGAP/RecO  
IPR001164  ArfGAP_dom  
IPR038508  ArfGAP_dom_sf  
Gene Ontology GO:0005096  F:GTPase activator activity  
KEGG ppa:PAS_chr3_1109  -  
Pfam View protein in Pfam  
PF01412  ArfGap  
PROSITE View protein in PROSITE  
PS50115  ARFGAP  
CDD cd08204  ArfGap  
Amino Acid Sequences MAKASRSESLLLEIINSSENSNKCGECGSCYPTWASWNLGVLLCGRCASLHRVLGFDVSRVKSLSLEEWNEKELQQLKVLGNKKNTKKWNPKRIPFPFDEDDKTGMEAWIKDKYIKGKFLNESYEELDYNLGYPRSSTKSASKSPSFESDDFSRIGNRSYTKLSSSKTESRHNSEVPPPLPRRRENSLTANKITTINSETDWLSRPSSSPAPAHHQQSTFQPMIISEAPDQTFMQPQIYQYVDPIDGLLKYVDQNGQQYIDSAQYQNFYQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.11
5 0.16
6 0.17
7 0.19
8 0.22
9 0.21
10 0.2
11 0.23
12 0.22
13 0.22
14 0.25
15 0.28
16 0.26
17 0.27
18 0.28
19 0.26
20 0.28
21 0.24
22 0.23
23 0.19
24 0.21
25 0.21
26 0.19
27 0.19
28 0.19
29 0.18
30 0.15
31 0.14
32 0.12
33 0.1
34 0.12
35 0.17
36 0.2
37 0.23
38 0.23
39 0.24
40 0.24
41 0.28
42 0.26
43 0.22
44 0.23
45 0.2
46 0.21
47 0.2
48 0.2
49 0.17
50 0.18
51 0.2
52 0.19
53 0.22
54 0.24
55 0.25
56 0.27
57 0.27
58 0.25
59 0.26
60 0.25
61 0.23
62 0.21
63 0.24
64 0.23
65 0.3
66 0.35
67 0.36
68 0.4
69 0.47
70 0.52
71 0.57
72 0.65
73 0.68
74 0.74
75 0.8
76 0.83
77 0.84
78 0.85
79 0.87
80 0.86
81 0.82
82 0.73
83 0.7
84 0.62
85 0.55
86 0.51
87 0.42
88 0.35
89 0.29
90 0.27
91 0.2
92 0.17
93 0.14
94 0.12
95 0.12
96 0.13
97 0.13
98 0.13
99 0.15
100 0.22
101 0.25
102 0.3
103 0.31
104 0.34
105 0.36
106 0.38
107 0.39
108 0.33
109 0.32
110 0.27
111 0.26
112 0.19
113 0.17
114 0.14
115 0.11
116 0.1
117 0.09
118 0.07
119 0.06
120 0.06
121 0.09
122 0.12
123 0.14
124 0.16
125 0.2
126 0.26
127 0.31
128 0.36
129 0.36
130 0.35
131 0.35
132 0.39
133 0.38
134 0.33
135 0.32
136 0.28
137 0.27
138 0.26
139 0.24
140 0.2
141 0.15
142 0.16
143 0.15
144 0.15
145 0.15
146 0.18
147 0.19
148 0.2
149 0.23
150 0.24
151 0.25
152 0.3
153 0.35
154 0.36
155 0.43
156 0.45
157 0.48
158 0.52
159 0.49
160 0.46
161 0.45
162 0.47
163 0.4
164 0.43
165 0.41
166 0.44
167 0.49
168 0.5
169 0.51
170 0.51
171 0.55
172 0.53
173 0.58
174 0.6
175 0.59
176 0.56
177 0.51
178 0.45
179 0.41
180 0.36
181 0.28
182 0.21
183 0.16
184 0.15
185 0.16
186 0.15
187 0.15
188 0.17
189 0.17
190 0.16
191 0.15
192 0.16
193 0.19
194 0.22
195 0.23
196 0.24
197 0.26
198 0.32
199 0.37
200 0.41
201 0.4
202 0.38
203 0.37
204 0.4
205 0.43
206 0.36
207 0.31
208 0.26
209 0.22
210 0.26
211 0.25
212 0.21
213 0.16
214 0.19
215 0.19
216 0.2
217 0.21
218 0.17
219 0.21
220 0.19
221 0.21
222 0.18
223 0.18
224 0.21
225 0.22
226 0.21
227 0.18
228 0.2
229 0.17
230 0.16
231 0.16
232 0.13
233 0.11
234 0.12
235 0.11
236 0.09
237 0.1
238 0.13
239 0.15
240 0.16
241 0.19
242 0.2
243 0.22
244 0.21
245 0.21
246 0.2
247 0.2
248 0.2
249 0.19
250 0.18
251 0.18