Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VSG8

Protein Details
Accession K1VSG8    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSSKKPVAKKTNEPLLTHydrophilic
69-90INQKAKPKPKIRQRSPEPAPRFHydrophilic
NLS Segment(s)
PositionSequence
4-11RKSSKKPV
73-82AKPKPKIRQR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038567  T_Elf1_sf  
Amino Acid Sequences MGKRKSSKKPVAKKTNEPLLTSSPCSARSTARSSRLRSTVGPPCRSSLTTDLSVAVDVYCDWVDACDEINQKAKPKPKIRQRSPEPAPRFTENEDEDEDEPPRRKISSRDYDSDSDDEDDRRARKVARRAYDDDDEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.8
4 0.71
5 0.64
6 0.6
7 0.55
8 0.48
9 0.41
10 0.32
11 0.31
12 0.31
13 0.29
14 0.26
15 0.27
16 0.32
17 0.36
18 0.44
19 0.48
20 0.51
21 0.56
22 0.55
23 0.53
24 0.48
25 0.48
26 0.48
27 0.5
28 0.5
29 0.44
30 0.43
31 0.43
32 0.41
33 0.37
34 0.32
35 0.28
36 0.25
37 0.24
38 0.22
39 0.2
40 0.19
41 0.15
42 0.11
43 0.06
44 0.05
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.08
54 0.09
55 0.1
56 0.14
57 0.15
58 0.18
59 0.23
60 0.29
61 0.35
62 0.43
63 0.51
64 0.57
65 0.67
66 0.73
67 0.79
68 0.79
69 0.81
70 0.79
71 0.8
72 0.75
73 0.69
74 0.64
75 0.57
76 0.52
77 0.44
78 0.44
79 0.35
80 0.33
81 0.3
82 0.28
83 0.25
84 0.24
85 0.23
86 0.21
87 0.22
88 0.2
89 0.2
90 0.19
91 0.2
92 0.26
93 0.35
94 0.41
95 0.46
96 0.49
97 0.53
98 0.54
99 0.56
100 0.5
101 0.42
102 0.33
103 0.28
104 0.25
105 0.21
106 0.24
107 0.22
108 0.23
109 0.24
110 0.28
111 0.35
112 0.43
113 0.51
114 0.55
115 0.61
116 0.64
117 0.68
118 0.69
119 0.64