Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VKU1

Protein Details
Accession K1VKU1   
Localization Confidence High
Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-61GTSAGPRRQGDRRRNNGNRNGKRNGGHydrophilic
163-183AGPSQERRRNRSRKANKDSSAHydrophilic
213-238TKLTTNEKKESRPRKQHNVQQQPSLPHydrophilic
NLS Segment(s)
PositionSequence
44-57QGDRRRNNGNRNGK
169-227RRRNRSRKANKDSSAPKDQKPKEPRRTESPAPKVSSRRAAFEKGTKLTTNEKKESRPRK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MAATDLPQPGDGAYLARTPQPGDGAYLMSSSGGANGTSAGPRRQGDRRRNNGNRNGKRNGGGASTPTASTPTADASSISGPLENLSINGNSSAGPSQQTGNKQGRNRRNGDASRRRDPSKSNGDGTASGARTPKFQPNPSAPAFEPGQAIDFSTVIPAPTSNAGPSQERRRNRSRKANKDSSAPKDQKPKEPRRTESPAPKVSSRRAAFEKGTKLTTNEKKESRPRKQHNVQQQPSLPEADDLNSRLTRGLAKKPYIECPILLTPAVTPAPDTGPTVTTLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.16
5 0.16
6 0.18
7 0.19
8 0.18
9 0.18
10 0.18
11 0.17
12 0.17
13 0.16
14 0.14
15 0.11
16 0.11
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.07
23 0.08
24 0.1
25 0.13
26 0.14
27 0.19
28 0.2
29 0.25
30 0.34
31 0.43
32 0.51
33 0.6
34 0.67
35 0.74
36 0.82
37 0.87
38 0.88
39 0.89
40 0.88
41 0.85
42 0.81
43 0.73
44 0.66
45 0.59
46 0.51
47 0.43
48 0.34
49 0.28
50 0.26
51 0.23
52 0.2
53 0.18
54 0.17
55 0.14
56 0.14
57 0.12
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.12
65 0.11
66 0.09
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.07
73 0.07
74 0.07
75 0.08
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.11
84 0.14
85 0.17
86 0.23
87 0.29
88 0.35
89 0.39
90 0.48
91 0.55
92 0.59
93 0.61
94 0.58
95 0.6
96 0.61
97 0.66
98 0.67
99 0.65
100 0.65
101 0.65
102 0.63
103 0.57
104 0.54
105 0.52
106 0.51
107 0.48
108 0.42
109 0.39
110 0.37
111 0.35
112 0.34
113 0.29
114 0.2
115 0.17
116 0.17
117 0.16
118 0.17
119 0.19
120 0.24
121 0.25
122 0.27
123 0.31
124 0.33
125 0.39
126 0.37
127 0.38
128 0.3
129 0.29
130 0.27
131 0.23
132 0.19
133 0.13
134 0.13
135 0.1
136 0.1
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.04
145 0.05
146 0.06
147 0.06
148 0.06
149 0.08
150 0.09
151 0.12
152 0.17
153 0.26
154 0.33
155 0.37
156 0.44
157 0.53
158 0.61
159 0.68
160 0.75
161 0.76
162 0.79
163 0.84
164 0.87
165 0.79
166 0.78
167 0.77
168 0.72
169 0.72
170 0.65
171 0.6
172 0.61
173 0.62
174 0.63
175 0.66
176 0.7
177 0.71
178 0.76
179 0.76
180 0.74
181 0.79
182 0.77
183 0.77
184 0.75
185 0.71
186 0.66
187 0.66
188 0.62
189 0.59
190 0.6
191 0.51
192 0.48
193 0.45
194 0.46
195 0.45
196 0.46
197 0.48
198 0.41
199 0.43
200 0.38
201 0.37
202 0.42
203 0.47
204 0.48
205 0.49
206 0.5
207 0.56
208 0.65
209 0.73
210 0.74
211 0.76
212 0.78
213 0.82
214 0.87
215 0.88
216 0.89
217 0.89
218 0.83
219 0.8
220 0.75
221 0.68
222 0.6
223 0.53
224 0.42
225 0.32
226 0.28
227 0.21
228 0.19
229 0.17
230 0.2
231 0.18
232 0.18
233 0.18
234 0.18
235 0.23
236 0.26
237 0.34
238 0.37
239 0.41
240 0.47
241 0.5
242 0.57
243 0.56
244 0.52
245 0.43
246 0.41
247 0.4
248 0.36
249 0.32
250 0.25
251 0.19
252 0.22
253 0.22
254 0.16
255 0.14
256 0.14
257 0.16
258 0.17
259 0.19
260 0.16
261 0.17
262 0.19