Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VH03

Protein Details
Accession K1VH03   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-65ITKLHKEAKKQAKKAPGKTTNHydrophilic
NLS Segment(s)
PositionSequence
47-61KLHKEAKKQAKKAPG
Subcellular Location(s) mito_nucl 10.999, mito 10.5, nucl 10, cyto_nucl 9.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGFDPMPRAPLELPAYYRNAKDSNIVCKQHGNVECKACFNWKKNITKLHKEAKKQAKKAPGKTTNLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.31
5 0.28
6 0.26
7 0.24
8 0.27
9 0.27
10 0.31
11 0.37
12 0.38
13 0.35
14 0.35
15 0.35
16 0.36
17 0.39
18 0.34
19 0.3
20 0.33
21 0.32
22 0.31
23 0.31
24 0.31
25 0.31
26 0.31
27 0.37
28 0.41
29 0.47
30 0.52
31 0.62
32 0.63
33 0.67
34 0.71
35 0.72
36 0.71
37 0.7
38 0.75
39 0.76
40 0.78
41 0.75
42 0.75
43 0.75
44 0.78
45 0.81
46 0.81
47 0.8