Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6ZSR4

Protein Details
Accession A0A3M6ZSR4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-76AIVTGKKPQGRRRARSEDRKEEBasic
NLS Segment(s)
PositionSequence
60-74KKPQGRRRARSEDRK
Subcellular Location(s) plas 8, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADQPPTQQSKADKFMRGAGEVRDTNLWGPAKWVVQLVQYMVAIIMITIGEGFKAIVTGKKPQGRRRARSEDRKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.46
4 0.42
5 0.37
6 0.3
7 0.3
8 0.27
9 0.27
10 0.22
11 0.2
12 0.18
13 0.21
14 0.19
15 0.13
16 0.15
17 0.15
18 0.15
19 0.14
20 0.15
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.04
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.02
41 0.03
42 0.04
43 0.08
44 0.1
45 0.17
46 0.25
47 0.32
48 0.39
49 0.47
50 0.58
51 0.65
52 0.71
53 0.75
54 0.78
55 0.82
56 0.86