Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7B2T6

Protein Details
Accession A0A3M7B2T6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-127KSEREQRKEREEQRKKEGRSBasic
NLS Segment(s)
PositionSequence
111-154REQRKEREEQRKKEGRSNSRGEAENRSQSRRRGSGGLIEKGKEI
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MAEKPRILRDAAKNGEQIRSTSHGRGGAGNINSGPSSVRTADDMRTPEIKQPHYTTGRGGTGNIVSNDNPSNARLAQDVEAPRHHDRPAQGTFHWGRGGEGNMTVVGKSEREQRKEREEQRKKEGRSNSRGEAENRSQSRRRGSGGLIEKGKEILGIGGRGRAGAGGGSESAIEEEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.46
4 0.38
5 0.33
6 0.33
7 0.33
8 0.3
9 0.32
10 0.29
11 0.29
12 0.3
13 0.28
14 0.29
15 0.26
16 0.25
17 0.21
18 0.2
19 0.19
20 0.17
21 0.15
22 0.1
23 0.12
24 0.12
25 0.12
26 0.14
27 0.16
28 0.18
29 0.22
30 0.23
31 0.23
32 0.25
33 0.25
34 0.28
35 0.32
36 0.33
37 0.33
38 0.34
39 0.39
40 0.4
41 0.4
42 0.37
43 0.34
44 0.34
45 0.3
46 0.26
47 0.2
48 0.18
49 0.2
50 0.18
51 0.16
52 0.13
53 0.15
54 0.15
55 0.15
56 0.14
57 0.11
58 0.12
59 0.11
60 0.12
61 0.1
62 0.11
63 0.11
64 0.15
65 0.16
66 0.15
67 0.16
68 0.21
69 0.22
70 0.23
71 0.23
72 0.21
73 0.21
74 0.25
75 0.27
76 0.24
77 0.22
78 0.26
79 0.27
80 0.26
81 0.26
82 0.2
83 0.17
84 0.16
85 0.17
86 0.11
87 0.1
88 0.08
89 0.08
90 0.08
91 0.07
92 0.06
93 0.06
94 0.06
95 0.07
96 0.16
97 0.22
98 0.28
99 0.33
100 0.38
101 0.47
102 0.56
103 0.65
104 0.67
105 0.71
106 0.73
107 0.78
108 0.81
109 0.76
110 0.74
111 0.74
112 0.72
113 0.7
114 0.69
115 0.64
116 0.6
117 0.61
118 0.55
119 0.53
120 0.5
121 0.5
122 0.48
123 0.49
124 0.49
125 0.5
126 0.55
127 0.51
128 0.49
129 0.43
130 0.41
131 0.44
132 0.47
133 0.49
134 0.44
135 0.41
136 0.38
137 0.35
138 0.33
139 0.23
140 0.16
141 0.12
142 0.11
143 0.13
144 0.13
145 0.15
146 0.15
147 0.15
148 0.14
149 0.12
150 0.1
151 0.08
152 0.08
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08