Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7BDA5

Protein Details
Accession A0A3M7BDA5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
248-273DPPATATARRRARRQANKASRQHLSMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MNITRHLSSWYKDIKLVVIKLTEDETTYVLPKRMVCDMSEYFAKVLEEDSEETQLRTLKLSDCSAETFDVVLGFHVYYGLPHDIKSEHQAQLLLVNLWFFGDTYLLPHLKIEAFKVTSEILDHQPPCPGVLAEVLASGSKGLRLKSLFIVRAISCIIQGGYNEAERAELAEIEGFFKIMADVLAAAKSSQVIANALARAQNSYSRSLTNVTASVQTGIGSTLPTTATTVHPSYMPTSTPFQAGPPAFDPPATATARRRARRQANKASRQHLSMTQSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.4
4 0.35
5 0.31
6 0.29
7 0.28
8 0.29
9 0.24
10 0.18
11 0.17
12 0.15
13 0.15
14 0.17
15 0.18
16 0.18
17 0.2
18 0.2
19 0.22
20 0.26
21 0.26
22 0.23
23 0.28
24 0.28
25 0.29
26 0.29
27 0.27
28 0.22
29 0.23
30 0.22
31 0.15
32 0.14
33 0.12
34 0.12
35 0.13
36 0.15
37 0.17
38 0.17
39 0.17
40 0.18
41 0.19
42 0.17
43 0.16
44 0.17
45 0.16
46 0.19
47 0.21
48 0.21
49 0.2
50 0.21
51 0.21
52 0.2
53 0.17
54 0.14
55 0.12
56 0.11
57 0.09
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.08
66 0.11
67 0.1
68 0.1
69 0.12
70 0.13
71 0.14
72 0.19
73 0.21
74 0.19
75 0.2
76 0.2
77 0.19
78 0.2
79 0.2
80 0.15
81 0.1
82 0.09
83 0.07
84 0.07
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.06
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.11
97 0.11
98 0.11
99 0.12
100 0.12
101 0.12
102 0.14
103 0.13
104 0.12
105 0.12
106 0.13
107 0.12
108 0.15
109 0.16
110 0.15
111 0.16
112 0.16
113 0.16
114 0.14
115 0.11
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.03
126 0.05
127 0.06
128 0.07
129 0.09
130 0.1
131 0.12
132 0.16
133 0.19
134 0.18
135 0.18
136 0.2
137 0.17
138 0.18
139 0.17
140 0.13
141 0.09
142 0.09
143 0.08
144 0.06
145 0.06
146 0.07
147 0.07
148 0.08
149 0.08
150 0.07
151 0.07
152 0.06
153 0.07
154 0.06
155 0.05
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.03
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.07
180 0.09
181 0.1
182 0.1
183 0.11
184 0.1
185 0.11
186 0.11
187 0.15
188 0.15
189 0.19
190 0.2
191 0.19
192 0.2
193 0.22
194 0.22
195 0.2
196 0.18
197 0.16
198 0.16
199 0.16
200 0.15
201 0.13
202 0.12
203 0.1
204 0.09
205 0.08
206 0.07
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.09
213 0.11
214 0.15
215 0.16
216 0.16
217 0.16
218 0.17
219 0.19
220 0.19
221 0.19
222 0.17
223 0.21
224 0.21
225 0.22
226 0.21
227 0.19
228 0.26
229 0.25
230 0.26
231 0.23
232 0.26
233 0.25
234 0.24
235 0.25
236 0.2
237 0.26
238 0.25
239 0.27
240 0.27
241 0.37
242 0.47
243 0.52
244 0.56
245 0.6
246 0.69
247 0.76
248 0.82
249 0.84
250 0.85
251 0.89
252 0.91
253 0.87
254 0.81
255 0.73
256 0.66
257 0.62
258 0.57