Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7B510

Protein Details
Accession A0A3M7B510    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84ELAARRRKKNALKVKQRYLDHydrophilic
NLS Segment(s)
PositionSequence
69-76RRRKKNAL
121-128FKVRERKR
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MGGKKVVFDEEGEMVGGGEAGGEEFDDLGMDMDDLADLDGLDGPDDSADVEMEEEEEEEGLSKEELAARRRKKNALKVKQRYLDALRDREDQLTEALRRVEAQRARMNGTVGGVNKNGVKFKVRERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.06
52 0.1
53 0.14
54 0.22
55 0.28
56 0.36
57 0.4
58 0.47
59 0.53
60 0.6
61 0.67
62 0.69
63 0.74
64 0.76
65 0.81
66 0.78
67 0.72
68 0.66
69 0.59
70 0.57
71 0.52
72 0.48
73 0.42
74 0.4
75 0.4
76 0.37
77 0.34
78 0.26
79 0.21
80 0.22
81 0.19
82 0.18
83 0.18
84 0.16
85 0.17
86 0.18
87 0.24
88 0.23
89 0.29
90 0.33
91 0.35
92 0.39
93 0.39
94 0.39
95 0.31
96 0.29
97 0.27
98 0.22
99 0.23
100 0.19
101 0.19
102 0.21
103 0.22
104 0.24
105 0.22
106 0.26
107 0.27
108 0.38