Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6W064

Protein Details
Accession A0A3M6W064    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-40LILADKAKQRKQEKKDKKKAHDDKRYKDLEKBasic
NLS Segment(s)
PositionSequence
15-36KAKQRKQEKKDKKKAHDDKRYK
Subcellular Location(s) nucl 20, mito_nucl 12.833, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MAALLIGGSLILADKAKQRKQEKKDKKKAHDDKRYKDLEKETKLRLERSQSGKVEKLVEVNDDDESDKASGSKDGDDEQQQQQQQRQQRTPSYTEAEWAEMFPNELPLKKKPIIYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.22
3 0.27
4 0.36
5 0.46
6 0.55
7 0.65
8 0.75
9 0.8
10 0.83
11 0.9
12 0.91
13 0.91
14 0.92
15 0.93
16 0.93
17 0.93
18 0.91
19 0.88
20 0.86
21 0.84
22 0.74
23 0.69
24 0.67
25 0.65
26 0.62
27 0.6
28 0.54
29 0.54
30 0.54
31 0.52
32 0.46
33 0.43
34 0.43
35 0.44
36 0.48
37 0.43
38 0.44
39 0.43
40 0.41
41 0.36
42 0.29
43 0.25
44 0.18
45 0.16
46 0.13
47 0.12
48 0.11
49 0.09
50 0.1
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.13
63 0.16
64 0.19
65 0.21
66 0.25
67 0.27
68 0.3
69 0.33
70 0.37
71 0.41
72 0.46
73 0.48
74 0.5
75 0.55
76 0.57
77 0.57
78 0.56
79 0.54
80 0.45
81 0.42
82 0.37
83 0.32
84 0.27
85 0.24
86 0.2
87 0.15
88 0.16
89 0.13
90 0.17
91 0.16
92 0.19
93 0.23
94 0.26
95 0.33
96 0.36