FuNGI

K1WL22

Protein Details

Accession

K1WL22

Localization Confidence

Low

Confidence Score

5.8

NoLS Segment(s)

Position	Sequence	Protein Nature
461-480	AAPTSETRVRIKRRKFEWVE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 10, mito 8, cyto 3, vacu 3, nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036396 Cyt_P450_sf
Gene Ontology	GO:0016020 C:membrane GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
KEGG	mbe:MBM_08259 -

Amino Acid Sequences

MSTNFYDTAQDPNLVSQGLFYQLWQAVPISPIILATLLLGPLIIFLTASLLLIGGVEKPEDESERDVWMLPFQPVPWRILESFFGIPKRVELRYQEALEELNACSKYLLDEPHMTKIIKNLVQNLERNTPQMISFVDSPIDLQPWERYAEARFISLSETELNLTSLLRDMIGHAAVPAVFGHALIEKYPSILHDVRDMDAGRSYLLRKLPAWLPWPAVIQAHMARLKVWKCLDDHQKAVDAAVSEEDIEGSWGDLGDVSEFIMKRNEVYRRYGIEVKERAEISVLWSLAANSALISYWQIHHILTIPGLVDRIRAEITPYASVAKPFSIGTIFEAPKLKLDYDSLLARCPLLKSTFLETLRQVDEQWGLRKSFLGDVNPVDNITFPEKFNPDRYLESLPEERKGSITSAGSLDSSLQKSNRFVEIECLAFVAAILVFWDITPADKSTGWTIPEKQRLGGIAAPTSETRVRIKRRKFEWVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.19
3	0.13
4	0.13
5	0.15
6	0.14
7	0.12
8	0.16
9	0.18
10	0.18
11	0.18
12	0.18
13	0.15
14	0.16
15	0.16
16	0.11
17	0.1
18	0.1
19	0.09
20	0.08
21	0.07
22	0.07
23	0.08
24	0.07
25	0.06
26	0.06
27	0.06
28	0.06
29	0.06
30	0.05
31	0.03
32	0.03
33	0.05
34	0.06
35	0.06
36	0.05
37	0.05
38	0.05
39	0.05
40	0.06
41	0.05
42	0.06
43	0.06
44	0.06
45	0.08
46	0.1
47	0.12
48	0.14
49	0.17
50	0.18
51	0.2
52	0.21
53	0.2
54	0.19
55	0.2
56	0.19
57	0.17
58	0.17
59	0.15
60	0.22
61	0.23
62	0.24
63	0.23
64	0.25
65	0.25
66	0.26
67	0.27
68	0.24
69	0.25
70	0.27
71	0.26
72	0.24
73	0.23
74	0.25
75	0.28
76	0.25
77	0.26
78	0.28
79	0.33
80	0.38
81	0.39
82	0.35
83	0.31
84	0.3
85	0.26
86	0.23
87	0.16
88	0.15
89	0.14
90	0.13
91	0.13
92	0.12
93	0.14
94	0.15
95	0.17
96	0.16
97	0.23
98	0.25
99	0.3
100	0.33
101	0.31
102	0.29
103	0.31
104	0.35
105	0.32
106	0.32
107	0.33
108	0.37
109	0.41
110	0.44
111	0.44
112	0.42
113	0.39
114	0.39
115	0.33
116	0.27
117	0.23
118	0.21
119	0.17
120	0.14
121	0.15
122	0.14
123	0.13
124	0.12
125	0.13
126	0.12
127	0.12
128	0.09
129	0.09
130	0.1
131	0.11
132	0.13
133	0.12
134	0.12
135	0.13
136	0.18
137	0.18
138	0.17
139	0.15
140	0.14
141	0.15
142	0.14
143	0.14
144	0.09
145	0.09
146	0.09
147	0.1
148	0.1
149	0.08
150	0.08
151	0.07
152	0.07
153	0.06
154	0.06
155	0.05
156	0.06
157	0.07
158	0.07
159	0.07
160	0.06
161	0.06
162	0.06
163	0.06
164	0.05
165	0.04
166	0.04
167	0.04
168	0.05
169	0.06
170	0.06
171	0.06
172	0.08
173	0.07
174	0.08
175	0.08
176	0.08
177	0.12
178	0.13
179	0.14
180	0.17
181	0.18
182	0.18
183	0.21
184	0.21
185	0.16
186	0.15
187	0.15
188	0.1
189	0.11
190	0.11
191	0.12
192	0.13
193	0.14
194	0.13
195	0.17
196	0.19
197	0.22
198	0.24
199	0.22
200	0.22
201	0.21
202	0.22
203	0.19
204	0.17
205	0.14
206	0.13
207	0.12
208	0.15
209	0.15
210	0.14
211	0.14
212	0.18
213	0.19
214	0.21
215	0.21
216	0.19
217	0.2
218	0.27
219	0.36
220	0.34
221	0.35
222	0.31
223	0.32
224	0.3
225	0.28
226	0.22
227	0.13
228	0.1
229	0.08
230	0.07
231	0.05
232	0.05
233	0.05
234	0.04
235	0.04
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.06
247	0.06
248	0.07
249	0.08
250	0.08
251	0.09
252	0.14
253	0.2
254	0.2
255	0.25
256	0.28
257	0.29
258	0.33
259	0.36
260	0.33
261	0.36
262	0.36
263	0.33
264	0.33
265	0.31
266	0.27
267	0.23
268	0.22
269	0.17
270	0.17
271	0.15
272	0.11
273	0.11
274	0.11
275	0.11
276	0.11
277	0.08
278	0.04
279	0.04
280	0.04
281	0.04
282	0.05
283	0.05
284	0.06
285	0.07
286	0.08
287	0.08
288	0.08
289	0.1
290	0.09
291	0.09
292	0.09
293	0.08
294	0.07
295	0.08
296	0.07
297	0.07
298	0.07
299	0.08
300	0.08
301	0.08
302	0.1
303	0.12
304	0.14
305	0.14
306	0.14
307	0.15
308	0.14
309	0.15
310	0.14
311	0.12
312	0.11
313	0.1
314	0.11
315	0.09
316	0.09
317	0.12
318	0.18
319	0.18
320	0.2
321	0.22
322	0.22
323	0.24
324	0.25
325	0.22
326	0.16
327	0.18
328	0.17
329	0.17
330	0.22
331	0.19
332	0.19
333	0.18
334	0.18
335	0.18
336	0.16
337	0.16
338	0.14
339	0.16
340	0.17
341	0.22
342	0.29
343	0.29
344	0.31
345	0.29
346	0.31
347	0.31
348	0.28
349	0.24
350	0.19
351	0.22
352	0.23
353	0.27
354	0.26
355	0.25
356	0.25
357	0.26
358	0.25
359	0.26
360	0.26
361	0.23
362	0.23
363	0.25
364	0.26
365	0.25
366	0.24
367	0.18
368	0.15
369	0.15
370	0.17
371	0.16
372	0.15
373	0.2
374	0.24
375	0.27
376	0.31
377	0.33
378	0.31
379	0.34
380	0.37
381	0.37
382	0.34
383	0.37
384	0.4
385	0.37
386	0.38
387	0.36
388	0.33
389	0.29
390	0.29
391	0.25
392	0.23
393	0.22
394	0.19
395	0.19
396	0.19
397	0.18
398	0.16
399	0.16
400	0.16
401	0.17
402	0.19
403	0.21
404	0.23
405	0.26
406	0.3
407	0.33
408	0.3
409	0.29
410	0.3
411	0.31
412	0.29
413	0.26
414	0.23
415	0.18
416	0.15
417	0.14
418	0.1
419	0.06
420	0.05
421	0.05
422	0.05
423	0.05
424	0.05
425	0.06
426	0.05
427	0.07
428	0.09
429	0.11
430	0.13
431	0.14
432	0.16
433	0.2
434	0.24
435	0.25
436	0.28
437	0.35
438	0.42
439	0.5
440	0.49
441	0.46
442	0.44
443	0.43
444	0.42
445	0.38
446	0.31
447	0.25
448	0.24
449	0.26
450	0.23
451	0.26
452	0.24
453	0.23
454	0.28
455	0.35
456	0.45
457	0.53
458	0.63
459	0.69
460	0.73

K1WL22

3D AlphaFold-predicted Structure Viewer