Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PJL4

Protein Details
Accession A0A3N2PJL4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-80LSATVYTRNRDRNRRRKRTVLYNDIIRKHydrophilic
NLS Segment(s)
PositionSequence
65-69NRRRK
Subcellular Location(s) extr 9, mito 5, plas 5, nucl 3, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MINPISSLLGAPLWGCLVRIVLIKNKTIRTRLALMSSLSSLASCGVSVASAPLSATVYTRNRDRNRRRKRTVLYNDIIRKGERRNEEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.07
5 0.08
6 0.1
7 0.12
8 0.18
9 0.2
10 0.24
11 0.28
12 0.33
13 0.36
14 0.37
15 0.37
16 0.35
17 0.37
18 0.34
19 0.32
20 0.28
21 0.25
22 0.23
23 0.21
24 0.17
25 0.12
26 0.1
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.03
35 0.04
36 0.03
37 0.03
38 0.03
39 0.04
40 0.05
41 0.05
42 0.05
43 0.11
44 0.14
45 0.17
46 0.22
47 0.31
48 0.38
49 0.49
50 0.6
51 0.66
52 0.74
53 0.83
54 0.86
55 0.87
56 0.88
57 0.88
58 0.87
59 0.86
60 0.82
61 0.81
62 0.79
63 0.73
64 0.67
65 0.57
66 0.52
67 0.49
68 0.5