Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q7H9

Protein Details
Accession A0A3N2Q7H9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-63QKLLRIRKKKSLHLKKNHRLKNPVPPTKKKDQNNLNKTTKHydrophilic
NLS Segment(s)
PositionSequence
25-53KLLRIRKKKSLHLKKNHRLKNPVPPTKKK
Subcellular Location(s) nucl 20, mito_nucl 12.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MALRTVSMMHWHKTYWDDRLRPEQKLLRIRKKKSLHLKKNHRLKNPVPPTKKKDQNNLNKTTKGSNDLQQIRDIIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.37
4 0.38
5 0.42
6 0.53
7 0.55
8 0.51
9 0.55
10 0.52
11 0.51
12 0.57
13 0.62
14 0.62
15 0.67
16 0.7
17 0.73
18 0.73
19 0.74
20 0.76
21 0.77
22 0.77
23 0.78
24 0.85
25 0.84
26 0.88
27 0.86
28 0.82
29 0.78
30 0.71
31 0.72
32 0.71
33 0.72
34 0.7
35 0.71
36 0.72
37 0.75
38 0.8
39 0.75
40 0.75
41 0.75
42 0.78
43 0.79
44 0.81
45 0.77
46 0.71
47 0.67
48 0.62
49 0.55
50 0.49
51 0.44
52 0.41
53 0.45
54 0.47
55 0.47
56 0.44