Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PTC1

Protein Details
Accession A0A3N2PTC1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-31SPQSPPGSKPAPKRKRENRYKDAPPSVLHydrophilic
NLS Segment(s)
PositionSequence
11-21SKPAPKRKREN
49-62GKRKEEGKGKKKNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDSPQSPPGSKPAPKRKRENRYKDAPPSVLSVCLPGSGVIHFGFVQGGKRKEEGKGKKKNKLTFDCSDDGPRIEPHSAPTARERTSASRTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.78
4 0.82
5 0.86
6 0.91
7 0.9
8 0.88
9 0.88
10 0.88
11 0.86
12 0.81
13 0.72
14 0.62
15 0.55
16 0.47
17 0.39
18 0.29
19 0.21
20 0.15
21 0.13
22 0.12
23 0.08
24 0.08
25 0.06
26 0.08
27 0.06
28 0.07
29 0.07
30 0.06
31 0.07
32 0.06
33 0.1
34 0.13
35 0.15
36 0.16
37 0.17
38 0.19
39 0.23
40 0.33
41 0.4
42 0.45
43 0.54
44 0.61
45 0.68
46 0.75
47 0.77
48 0.77
49 0.75
50 0.73
51 0.67
52 0.66
53 0.6
54 0.53
55 0.5
56 0.42
57 0.34
58 0.29
59 0.25
60 0.22
61 0.21
62 0.2
63 0.2
64 0.27
65 0.27
66 0.27
67 0.33
68 0.36
69 0.36
70 0.39
71 0.4
72 0.37
73 0.43