Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2Q5R8

Protein Details
Accession A0A3N2Q5R8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-39LRSRRSSQIFPRRSKRRLKKVVYLVCVHydrophilic
NLS Segment(s)
PositionSequence
23-32PRRSKRRLKK
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTLSINHGPISNLRSRRSSQIFPRRSKRRLKKVVYLVCVDCVFIWTRDNGRNGKQLGKSEGIGIRSRVGFATEKKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.46
4 0.49
5 0.51
6 0.54
7 0.59
8 0.65
9 0.69
10 0.77
11 0.78
12 0.79
13 0.83
14 0.83
15 0.83
16 0.84
17 0.82
18 0.81
19 0.82
20 0.81
21 0.73
22 0.66
23 0.55
24 0.46
25 0.4
26 0.3
27 0.2
28 0.14
29 0.12
30 0.09
31 0.09
32 0.09
33 0.12
34 0.16
35 0.21
36 0.23
37 0.25
38 0.31
39 0.32
40 0.38
41 0.38
42 0.38
43 0.38
44 0.38
45 0.34
46 0.32
47 0.33
48 0.3
49 0.28
50 0.26
51 0.25
52 0.22
53 0.23
54 0.19
55 0.19
56 0.21
57 0.22