FuNGI

A0A3N2PZW5

Protein Details

Accession

A0A3N2PZW5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
8-31	VAGYRVSPRRRSLRRLFRSRVIHL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 8, plas 7, mito 6, E.R. 2, golg 2

Family & Domain DBs

InterPro	View protein in InterPro IPR021047 Mannosyltransferase_CMT1
Pfam	View protein in Pfam PF11735 CAP59_mtransfer

Amino Acid Sequences

MTRIAAAVAGYRVSPRRRSLRRLFRSRVIHLIFLFLFLVTFFNAFCIHRRIAHLDRPPAAFDVPRKQERIYIAALHWNDAALVRDHWTPAVLDLVDALGRDNVFVSVYESGSWDTTKAELATLDAQLAARGVRRNIVLDISTHQDELERNMPPEGHPLPEGWMKTPRSRAEMRRIPFLARLRNMTLRDLWDLADKGERYDKVLFLNDVVFSVQDVLTLLDTNRGIYAAACSLDFSDHAEFYDTFALRDIRGDAYLTATWPFFRAPASRSAMVAHSDAVPVQSCWNGIVAMPAAPFTSSAKHKRLQFRSIPDSLATLHLEASECCLVHVDNPLSGELGVYLNPRVRVAYQPEAYAAVNPADGSSWVSMWAIAKGLWWHRLLAWFTTDALKGHVVDKRMKTWEAQSVSHQEPGRVCIINEGQVLVWNGWKHV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.34
2	0.4
3	0.5
4	0.58
5	0.68
6	0.74
7	0.79
8	0.83
9	0.88
10	0.86
11	0.85
12	0.84
13	0.79
14	0.78
15	0.7
16	0.63
17	0.53
18	0.5
19	0.4
20	0.33
21	0.29
22	0.18
23	0.15
24	0.11
25	0.12
26	0.07
27	0.08
28	0.06
29	0.07
30	0.09
31	0.11
32	0.14
33	0.19
34	0.2
35	0.24
36	0.28
37	0.34
38	0.39
39	0.47
40	0.51
41	0.53
42	0.55
43	0.53
44	0.51
45	0.45
46	0.4
47	0.35
48	0.33
49	0.36
50	0.4
51	0.44
52	0.45
53	0.43
54	0.47
55	0.46
56	0.45
57	0.38
58	0.33
59	0.29
60	0.34
61	0.33
62	0.3
63	0.26
64	0.22
65	0.18
66	0.16
67	0.16
68	0.11
69	0.11
70	0.12
71	0.13
72	0.14
73	0.14
74	0.14
75	0.12
76	0.11
77	0.13
78	0.1
79	0.09
80	0.09
81	0.09
82	0.08
83	0.08
84	0.08
85	0.06
86	0.06
87	0.06
88	0.07
89	0.06
90	0.07
91	0.07
92	0.09
93	0.09
94	0.09
95	0.09
96	0.1
97	0.11
98	0.11
99	0.11
100	0.09
101	0.09
102	0.09
103	0.1
104	0.09
105	0.09
106	0.08
107	0.1
108	0.11
109	0.11
110	0.1
111	0.09
112	0.09
113	0.08
114	0.08
115	0.07
116	0.08
117	0.1
118	0.11
119	0.13
120	0.14
121	0.15
122	0.16
123	0.17
124	0.15
125	0.13
126	0.15
127	0.17
128	0.17
129	0.15
130	0.14
131	0.14
132	0.14
133	0.17
134	0.19
135	0.16
136	0.16
137	0.17
138	0.17
139	0.16
140	0.22
141	0.19
142	0.17
143	0.16
144	0.15
145	0.18
146	0.21
147	0.21
148	0.17
149	0.23
150	0.24
151	0.27
152	0.34
153	0.33
154	0.35
155	0.41
156	0.45
157	0.49
158	0.54
159	0.52
160	0.52
161	0.51
162	0.47
163	0.47
164	0.46
165	0.42
166	0.36
167	0.37
168	0.33
169	0.37
170	0.37
171	0.33
172	0.29
173	0.24
174	0.24
175	0.21
176	0.18
177	0.16
178	0.15
179	0.13
180	0.15
181	0.13
182	0.13
183	0.16
184	0.16
185	0.16
186	0.18
187	0.18
188	0.16
189	0.17
190	0.16
191	0.13
192	0.14
193	0.11
194	0.09
195	0.09
196	0.07
197	0.05
198	0.06
199	0.05
200	0.04
201	0.05
202	0.05
203	0.05
204	0.05
205	0.05
206	0.06
207	0.07
208	0.07
209	0.06
210	0.06
211	0.06
212	0.06
213	0.07
214	0.05
215	0.06
216	0.05
217	0.05
218	0.06
219	0.06
220	0.06
221	0.07
222	0.07
223	0.07
224	0.07
225	0.09
226	0.09
227	0.1
228	0.15
229	0.13
230	0.12
231	0.13
232	0.14
233	0.11
234	0.12
235	0.12
236	0.09
237	0.09
238	0.09
239	0.08
240	0.1
241	0.1
242	0.1
243	0.09
244	0.09
245	0.08
246	0.09
247	0.09
248	0.07
249	0.09
250	0.1
251	0.11
252	0.18
253	0.23
254	0.23
255	0.23
256	0.24
257	0.23
258	0.23
259	0.21
260	0.15
261	0.11
262	0.1
263	0.1
264	0.09
265	0.09
266	0.07
267	0.08
268	0.08
269	0.07
270	0.07
271	0.08
272	0.07
273	0.07
274	0.08
275	0.07
276	0.07
277	0.07
278	0.07
279	0.07
280	0.07
281	0.07
282	0.07
283	0.11
284	0.17
285	0.24
286	0.29
287	0.34
288	0.41
289	0.51
290	0.56
291	0.6
292	0.61
293	0.62
294	0.65
295	0.62
296	0.56
297	0.46
298	0.4
299	0.33
300	0.28
301	0.21
302	0.14
303	0.12
304	0.11
305	0.11
306	0.1
307	0.13
308	0.12
309	0.11
310	0.11
311	0.11
312	0.11
313	0.12
314	0.18
315	0.15
316	0.15
317	0.16
318	0.16
319	0.16
320	0.15
321	0.14
322	0.08
323	0.08
324	0.08
325	0.08
326	0.1
327	0.12
328	0.13
329	0.14
330	0.14
331	0.15
332	0.2
333	0.26
334	0.32
335	0.31
336	0.31
337	0.32
338	0.32
339	0.31
340	0.26
341	0.21
342	0.13
343	0.11
344	0.11
345	0.1
346	0.08
347	0.09
348	0.1
349	0.09
350	0.08
351	0.09
352	0.09
353	0.1
354	0.1
355	0.11
356	0.09
357	0.08
358	0.1
359	0.14
360	0.18
361	0.22
362	0.22
363	0.22
364	0.23
365	0.3
366	0.3
367	0.28
368	0.27
369	0.23
370	0.23
371	0.25
372	0.25
373	0.19
374	0.19
375	0.19
376	0.17
377	0.21
378	0.23
379	0.24
380	0.31
381	0.35
382	0.39
383	0.42
384	0.42
385	0.41
386	0.44
387	0.49
388	0.46
389	0.44
390	0.43
391	0.45
392	0.47
393	0.5
394	0.45
395	0.39
396	0.36
397	0.38
398	0.36
399	0.3
400	0.28
401	0.29
402	0.3
403	0.32
404	0.3
405	0.28
406	0.23
407	0.25
408	0.28
409	0.21
410	0.23

A0A3N2PZW5

3D AlphaFold-predicted Structure Viewer