Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PU67

Protein Details
Accession A0A3N2PU67    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
239-259IPGPPLYNARKTRRHAKDIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MAQKTLLATILGAASVAAHGFVETITVNGQTYESYNPATFPYMPNPPPVPGWTADFPDLGFVEPAAAGNPDIICHRSATPGQSHISVSAGDTLTLQWTPWPESHKGPVIDYLANCNGDCSNVDKTSLQFFKIAEQGLITPGDPATAFWAADKLIADGEVWEVTIPEDIAPGSYVLRHEILALHSGSQPNGAQFYPQCINLQISGSGSANPSGVPGTSLYTAQDPGVLFNIWTAVDSYPIPGPPLYNARKTRRHAKDIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.08
17 0.08
18 0.1
19 0.11
20 0.12
21 0.14
22 0.14
23 0.15
24 0.16
25 0.19
26 0.18
27 0.18
28 0.22
29 0.27
30 0.28
31 0.33
32 0.33
33 0.32
34 0.32
35 0.32
36 0.29
37 0.23
38 0.27
39 0.23
40 0.24
41 0.24
42 0.22
43 0.2
44 0.19
45 0.17
46 0.13
47 0.11
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.09
60 0.09
61 0.1
62 0.11
63 0.13
64 0.15
65 0.18
66 0.19
67 0.21
68 0.22
69 0.22
70 0.21
71 0.18
72 0.18
73 0.14
74 0.12
75 0.12
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.06
84 0.08
85 0.1
86 0.12
87 0.16
88 0.17
89 0.2
90 0.23
91 0.27
92 0.26
93 0.25
94 0.26
95 0.24
96 0.23
97 0.21
98 0.21
99 0.18
100 0.18
101 0.17
102 0.15
103 0.12
104 0.11
105 0.11
106 0.11
107 0.12
108 0.12
109 0.13
110 0.13
111 0.14
112 0.2
113 0.2
114 0.18
115 0.15
116 0.15
117 0.16
118 0.18
119 0.17
120 0.11
121 0.1
122 0.1
123 0.1
124 0.1
125 0.08
126 0.06
127 0.05
128 0.06
129 0.05
130 0.05
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.08
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.06
160 0.06
161 0.08
162 0.08
163 0.08
164 0.08
165 0.09
166 0.1
167 0.12
168 0.12
169 0.11
170 0.13
171 0.14
172 0.13
173 0.14
174 0.13
175 0.11
176 0.13
177 0.12
178 0.12
179 0.12
180 0.17
181 0.17
182 0.18
183 0.18
184 0.18
185 0.2
186 0.18
187 0.19
188 0.14
189 0.13
190 0.14
191 0.14
192 0.13
193 0.13
194 0.12
195 0.11
196 0.1
197 0.1
198 0.08
199 0.08
200 0.08
201 0.07
202 0.09
203 0.1
204 0.11
205 0.12
206 0.13
207 0.13
208 0.12
209 0.14
210 0.12
211 0.12
212 0.14
213 0.13
214 0.11
215 0.11
216 0.12
217 0.09
218 0.09
219 0.1
220 0.08
221 0.1
222 0.1
223 0.12
224 0.13
225 0.14
226 0.15
227 0.14
228 0.15
229 0.18
230 0.27
231 0.31
232 0.38
233 0.46
234 0.54
235 0.63
236 0.69
237 0.75
238 0.75
239 0.8