Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q4V1

Protein Details
Accession A0A3N2Q4V1   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37ALTECRAGGKKRKKKNRAGLIRLQLDHydrophilic
106-127VVFRRKRNTIAARKYRQKKVDRHydrophilic
NLS Segment(s)
PositionSequence
19-29GGKKRKKKNRA
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR004826  bZIP_Maf  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF03131  bZIP_Maf  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MTSRLDQVRAVALTECRAGGKKRKKKNRAGLIRLQLDLFQISDFSQLVPSAVPNPSPSIPLPAATPSPAHSSLTVNTLSLAAAPASEIQSTSTSRQRERDKDDPDVVFRRKRNTIAARKYRQKKVDRIEELEKALEETIKERDELKLRLARQEAETEALKAVMRLGKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.15
4 0.19
5 0.23
6 0.32
7 0.41
8 0.49
9 0.59
10 0.7
11 0.79
12 0.86
13 0.91
14 0.91
15 0.91
16 0.9
17 0.89
18 0.86
19 0.79
20 0.69
21 0.59
22 0.48
23 0.38
24 0.3
25 0.2
26 0.11
27 0.08
28 0.08
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.07
36 0.08
37 0.09
38 0.09
39 0.1
40 0.1
41 0.13
42 0.13
43 0.15
44 0.15
45 0.17
46 0.17
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.11
54 0.15
55 0.15
56 0.15
57 0.14
58 0.15
59 0.15
60 0.17
61 0.16
62 0.11
63 0.1
64 0.1
65 0.08
66 0.07
67 0.06
68 0.04
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.07
77 0.09
78 0.12
79 0.16
80 0.19
81 0.21
82 0.28
83 0.34
84 0.4
85 0.46
86 0.52
87 0.52
88 0.54
89 0.57
90 0.51
91 0.48
92 0.48
93 0.45
94 0.43
95 0.41
96 0.42
97 0.41
98 0.42
99 0.47
100 0.5
101 0.56
102 0.6
103 0.68
104 0.71
105 0.78
106 0.84
107 0.83
108 0.82
109 0.8
110 0.79
111 0.78
112 0.79
113 0.75
114 0.73
115 0.7
116 0.64
117 0.58
118 0.49
119 0.4
120 0.3
121 0.24
122 0.19
123 0.14
124 0.12
125 0.15
126 0.15
127 0.15
128 0.16
129 0.21
130 0.26
131 0.27
132 0.32
133 0.34
134 0.35
135 0.42
136 0.44
137 0.41
138 0.38
139 0.4
140 0.34
141 0.31
142 0.31
143 0.25
144 0.23
145 0.21
146 0.18
147 0.14
148 0.16
149 0.15