Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PW44

Protein Details
Accession A0A3N2PW44    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-62EWRVEEKKEKREKREKREKREERVHEAGEBasic
NLS Segment(s)
PositionSequence
39-54EKKEKREKREKREKRE
Subcellular Location(s) nucl 13, mito 11.5, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences MRQPLRKIASKDSQKTCDMVGVGTWKCRNSESGEWRVEEKKEKREKREKREKREERVHEAGELTALLELGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.58
3 0.5
4 0.42
5 0.32
6 0.24
7 0.17
8 0.18
9 0.17
10 0.2
11 0.22
12 0.2
13 0.2
14 0.21
15 0.21
16 0.22
17 0.29
18 0.32
19 0.37
20 0.38
21 0.37
22 0.39
23 0.39
24 0.35
25 0.35
26 0.34
27 0.37
28 0.46
29 0.52
30 0.6
31 0.69
32 0.78
33 0.8
34 0.87
35 0.87
36 0.87
37 0.92
38 0.91
39 0.91
40 0.91
41 0.87
42 0.85
43 0.81
44 0.72
45 0.62
46 0.53
47 0.43
48 0.33
49 0.25
50 0.16
51 0.09