Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2L542

Protein Details
Accession E2L542    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-100ESGAKRLRSRRLWQAPCCPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR004044  KH_dom_type_2  
IPR009019  KH_sf_prok-type  
IPR036419  Ribosomal_S3_C_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
KEGG mpr:MPER_00865  -  
Pfam View protein in Pfam  
PF07650  KH_2  
Amino Acid Sequences IIIRATHTQEVLGEKGRRIRELTALVQKRFKFPENSLELYAEKVQYRGLSAIAQCESLRYKLLNGLAVRRACYGVLRFVMESGAKRLRSRRLWQAPCCPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.34
4 0.34
5 0.34
6 0.33
7 0.32
8 0.35
9 0.38
10 0.42
11 0.46
12 0.46
13 0.49
14 0.48
15 0.47
16 0.46
17 0.43
18 0.38
19 0.35
20 0.41
21 0.41
22 0.43
23 0.39
24 0.37
25 0.33
26 0.29
27 0.28
28 0.2
29 0.15
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.08
38 0.1
39 0.1
40 0.1
41 0.09
42 0.1
43 0.11
44 0.1
45 0.11
46 0.1
47 0.1
48 0.12
49 0.14
50 0.17
51 0.17
52 0.19
53 0.24
54 0.24
55 0.25
56 0.23
57 0.22
58 0.18
59 0.2
60 0.18
61 0.17
62 0.18
63 0.18
64 0.17
65 0.17
66 0.18
67 0.17
68 0.17
69 0.19
70 0.23
71 0.24
72 0.28
73 0.34
74 0.42
75 0.49
76 0.55
77 0.6
78 0.65
79 0.72
80 0.76