Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2Q4D7

Protein Details
Accession A0A3N2Q4D7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-83SDRPAHFGRPLKKRARRKEKDTSRLLGBasic
NLS Segment(s)
PositionSequence
64-76GRPLKKRARRKEK
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MRRRSVVEGKSAEKERKKEVLSLIQAKIIEVHDEQNRTEQVKQVKRFSIHWRNTDDSDRPAHFGRPLKKRARRKEKDTSRLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.57
4 0.54
5 0.51
6 0.51
7 0.51
8 0.51
9 0.53
10 0.47
11 0.42
12 0.4
13 0.35
14 0.31
15 0.23
16 0.18
17 0.12
18 0.15
19 0.16
20 0.17
21 0.17
22 0.19
23 0.2
24 0.2
25 0.2
26 0.2
27 0.26
28 0.32
29 0.36
30 0.37
31 0.4
32 0.4
33 0.44
34 0.49
35 0.51
36 0.5
37 0.51
38 0.52
39 0.51
40 0.53
41 0.53
42 0.46
43 0.38
44 0.37
45 0.33
46 0.31
47 0.29
48 0.28
49 0.29
50 0.34
51 0.4
52 0.44
53 0.52
54 0.59
55 0.68
56 0.77
57 0.83
58 0.87
59 0.88
60 0.88
61 0.9
62 0.9
63 0.9