Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PWJ8

Protein Details
Accession A0A3N2PWJ8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SSQHNQSRKAHRNGIKKVKTHydrophilic
NLS Segment(s)
PositionSequence
14-65RKAHRNGIKKVKTSRYPSLKGTDPKFRRNHRHALHGTARALKELREGKREKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKVKTSRYPSLKGTDPKFRRNHRHALHGTARALKELREGKREKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.78
6 0.79
7 0.82
8 0.78
9 0.75
10 0.75
11 0.74
12 0.74
13 0.71
14 0.71
15 0.68
16 0.64
17 0.6
18 0.57
19 0.54
20 0.52
21 0.49
22 0.5
23 0.46
24 0.51
25 0.56
26 0.61
27 0.65
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.65
34 0.63
35 0.58
36 0.55
37 0.5
38 0.47
39 0.4
40 0.38
41 0.3
42 0.32
43 0.34
44 0.37
45 0.41