Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7S4

Protein Details
Accession Q6U7S4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLGKVQKKSKKKQLPSLLPLAPHydrophilic
NLS Segment(s)
PositionSequence
42-64KEAGKESARKGNARKKKREGTEE
Subcellular Location(s) mito 17.5, mito_nucl 13.166, nucl 7.5, cyto_nucl 5.833
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MLGKVQKKSKKKQLPSLLPLAPVKSKGSVLPFPCCASQREAKEAGKESARKGNARKKKREGTEEREGEEKKVKSQLCNCSVVSLANIANYKSNTLQTAQLLVVEFLISIRIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.83
4 0.74
5 0.67
6 0.59
7 0.51
8 0.42
9 0.34
10 0.29
11 0.23
12 0.22
13 0.2
14 0.24
15 0.27
16 0.28
17 0.31
18 0.31
19 0.31
20 0.32
21 0.31
22 0.27
23 0.26
24 0.3
25 0.29
26 0.31
27 0.35
28 0.34
29 0.36
30 0.37
31 0.35
32 0.33
33 0.32
34 0.29
35 0.31
36 0.32
37 0.32
38 0.37
39 0.44
40 0.49
41 0.56
42 0.63
43 0.65
44 0.7
45 0.72
46 0.75
47 0.74
48 0.72
49 0.73
50 0.66
51 0.59
52 0.56
53 0.51
54 0.43
55 0.41
56 0.34
57 0.26
58 0.31
59 0.31
60 0.32
61 0.39
62 0.45
63 0.43
64 0.46
65 0.43
66 0.38
67 0.37
68 0.31
69 0.24
70 0.17
71 0.13
72 0.12
73 0.13
74 0.12
75 0.15
76 0.15
77 0.17
78 0.17
79 0.18
80 0.17
81 0.18
82 0.21
83 0.18
84 0.2
85 0.18
86 0.18
87 0.17
88 0.15
89 0.13
90 0.1
91 0.09
92 0.06
93 0.08