Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PJS2

Protein Details
Accession A0A3N2PJS2   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKAATKRGTVQKKRAKKDPNAPKRGLHydrophilic
NLS Segment(s)
PositionSequence
7-25KRGTVQKKRAKKDPNAPKR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAATKRGTVQKKRAKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNAEAEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.83
5 0.84
6 0.85
7 0.85
8 0.84
9 0.79
10 0.72
11 0.67
12 0.59
13 0.52
14 0.43
15 0.34
16 0.28
17 0.28
18 0.25
19 0.21
20 0.21
21 0.2
22 0.19
23 0.18
24 0.16
25 0.15
26 0.18
27 0.19
28 0.19
29 0.17
30 0.17
31 0.18
32 0.16
33 0.16
34 0.13
35 0.12
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.1
45 0.11
46 0.11
47 0.12
48 0.15
49 0.17
50 0.22
51 0.3
52 0.33
53 0.39
54 0.45
55 0.47
56 0.47
57 0.49
58 0.46
59 0.42
60 0.4
61 0.35
62 0.35
63 0.35
64 0.39
65 0.41
66 0.4
67 0.39
68 0.45
69 0.48
70 0.46
71 0.52
72 0.52
73 0.53
74 0.55
75 0.54
76 0.46
77 0.42
78 0.38
79 0.29