Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PYK6

Protein Details
Accession A0A3N2PYK6   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-38IFSLYKRPYKGNNNTNKRRAPKNPYGPRRLAHydrophilic
66-87SSYSRRYSRSRRHAAYRYRPAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLFLRPPIFSLYKRPYKGNNNTNKRRAPKNPYGPRRLAPYAYQAPALLAPILNIISAYTGLINTLSSYSRRYSRSRRHAAYRYRPAARHYPIRYYRVLDKKLKDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.62
4 0.71
5 0.71
6 0.73
7 0.74
8 0.81
9 0.85
10 0.85
11 0.81
12 0.79
13 0.79
14 0.77
15 0.77
16 0.79
17 0.81
18 0.81
19 0.82
20 0.77
21 0.7
22 0.68
23 0.6
24 0.51
25 0.42
26 0.4
27 0.37
28 0.34
29 0.31
30 0.24
31 0.21
32 0.19
33 0.18
34 0.1
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.06
53 0.06
54 0.09
55 0.11
56 0.16
57 0.21
58 0.27
59 0.37
60 0.47
61 0.57
62 0.64
63 0.68
64 0.73
65 0.78
66 0.81
67 0.82
68 0.82
69 0.79
70 0.75
71 0.71
72 0.67
73 0.68
74 0.64
75 0.63
76 0.56
77 0.59
78 0.6
79 0.62
80 0.6
81 0.55
82 0.59
83 0.59
84 0.63
85 0.61
86 0.59