Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PJB4

Protein Details
Accession A0A3N2PJB4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-51LASPASQKRKEQKQKQKQRGEPYDDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037652  Mim2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0070096  P:mitochondrial outer membrane translocase complex assembly  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
Pfam View protein in Pfam  
PF19117  Mim2  
Amino Acid Sequences MVIVPFAGKFMGRKFAYWSTNPPLFLASPASQKRKEQKQKQKQRGEPYDDDMTDNCLHAGWARYMEWMHNVEIRWTSKSRFNMIGAVEAAATL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.38
4 0.39
5 0.43
6 0.41
7 0.43
8 0.43
9 0.37
10 0.32
11 0.27
12 0.25
13 0.23
14 0.18
15 0.23
16 0.28
17 0.33
18 0.34
19 0.39
20 0.47
21 0.54
22 0.63
23 0.65
24 0.71
25 0.77
26 0.86
27 0.91
28 0.92
29 0.88
30 0.88
31 0.85
32 0.81
33 0.71
34 0.65
35 0.58
36 0.48
37 0.41
38 0.31
39 0.27
40 0.19
41 0.17
42 0.12
43 0.09
44 0.09
45 0.09
46 0.11
47 0.08
48 0.09
49 0.09
50 0.11
51 0.11
52 0.12
53 0.14
54 0.14
55 0.15
56 0.16
57 0.16
58 0.17
59 0.21
60 0.23
61 0.24
62 0.24
63 0.26
64 0.31
65 0.35
66 0.38
67 0.38
68 0.37
69 0.37
70 0.36
71 0.37
72 0.3
73 0.26