Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PWH7

Protein Details
Accession A0A3N2PWH7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-148VLSQRPDGPNRGRRRRGNGFHydrophilic
NLS Segment(s)
PositionSequence
139-144RGRRRR
Subcellular Location(s) nucl 14, cyto_nucl 12.833, cyto 9.5, cyto_mito 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
Amino Acid Sequences MPPTTTAAIDSMGIDGPNNTPSGGFVCKFAGCTAPPFQTQYLLNSHANVHSSARPHYCSVTGCPRSEGGKGFKRKNEMIRHGLVHESPGYICPFCPDRDHKYPRPDNLQRHVRVHHVDKHKDDPLLREVLSQRPDGPNRGRRRRGNGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.08
8 0.09
9 0.13
10 0.15
11 0.14
12 0.14
13 0.16
14 0.16
15 0.17
16 0.17
17 0.17
18 0.14
19 0.17
20 0.2
21 0.21
22 0.22
23 0.23
24 0.23
25 0.24
26 0.24
27 0.22
28 0.22
29 0.24
30 0.23
31 0.21
32 0.22
33 0.2
34 0.2
35 0.18
36 0.17
37 0.15
38 0.16
39 0.19
40 0.2
41 0.21
42 0.21
43 0.21
44 0.21
45 0.2
46 0.23
47 0.29
48 0.3
49 0.28
50 0.28
51 0.28
52 0.28
53 0.28
54 0.27
55 0.24
56 0.28
57 0.34
58 0.38
59 0.39
60 0.43
61 0.45
62 0.49
63 0.51
64 0.5
65 0.48
66 0.46
67 0.44
68 0.4
69 0.37
70 0.29
71 0.22
72 0.16
73 0.11
74 0.09
75 0.09
76 0.1
77 0.09
78 0.09
79 0.1
80 0.12
81 0.13
82 0.18
83 0.22
84 0.29
85 0.39
86 0.47
87 0.52
88 0.6
89 0.66
90 0.67
91 0.72
92 0.72
93 0.7
94 0.72
95 0.74
96 0.68
97 0.66
98 0.62
99 0.58
100 0.56
101 0.54
102 0.53
103 0.53
104 0.55
105 0.56
106 0.6
107 0.58
108 0.56
109 0.52
110 0.48
111 0.43
112 0.4
113 0.35
114 0.33
115 0.32
116 0.35
117 0.36
118 0.33
119 0.32
120 0.36
121 0.39
122 0.42
123 0.49
124 0.51
125 0.6
126 0.69
127 0.75
128 0.76