Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PQW9

Protein Details
Accession A0A3N2PQW9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-76ILLLCCLGSRRRRKRGRQPMYGTGWHydrophilic
NLS Segment(s)
PositionSequence
61-68RRRRKRGR
Subcellular Location(s) mito 6, plas 5, extr 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MAFLFPADELVKRQYYNCPSGYYYSNGRCRERSSWSWWGRWVLTGMIIFAFILLLCCLGSRRRRKRGRQPMYGTGWMTNNRFGGGPHQQPQQQPQYGQGYNQQQQQGGYHYGQQQQPQYGYGQGEYNAPPAYGQPPPQPQHTGQTFTPGEGYYGGHDGIQLQQPPQAYSRGVDGDFSPPPGPPPAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.4
4 0.4
5 0.38
6 0.38
7 0.4
8 0.41
9 0.36
10 0.37
11 0.39
12 0.46
13 0.48
14 0.5
15 0.49
16 0.52
17 0.53
18 0.53
19 0.5
20 0.5
21 0.55
22 0.55
23 0.54
24 0.53
25 0.52
26 0.45
27 0.41
28 0.34
29 0.24
30 0.22
31 0.19
32 0.15
33 0.11
34 0.1
35 0.08
36 0.07
37 0.06
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.11
46 0.2
47 0.3
48 0.41
49 0.51
50 0.62
51 0.72
52 0.82
53 0.88
54 0.89
55 0.89
56 0.86
57 0.83
58 0.79
59 0.72
60 0.61
61 0.51
62 0.45
63 0.37
64 0.31
65 0.25
66 0.2
67 0.17
68 0.16
69 0.14
70 0.16
71 0.19
72 0.22
73 0.23
74 0.26
75 0.28
76 0.29
77 0.34
78 0.36
79 0.32
80 0.28
81 0.29
82 0.32
83 0.29
84 0.29
85 0.3
86 0.29
87 0.3
88 0.34
89 0.31
90 0.26
91 0.26
92 0.26
93 0.23
94 0.2
95 0.17
96 0.17
97 0.19
98 0.23
99 0.25
100 0.27
101 0.27
102 0.26
103 0.26
104 0.24
105 0.21
106 0.18
107 0.17
108 0.14
109 0.13
110 0.12
111 0.13
112 0.13
113 0.14
114 0.12
115 0.11
116 0.1
117 0.11
118 0.13
119 0.13
120 0.16
121 0.2
122 0.28
123 0.3
124 0.34
125 0.37
126 0.36
127 0.42
128 0.43
129 0.41
130 0.33
131 0.39
132 0.35
133 0.31
134 0.31
135 0.23
136 0.2
137 0.16
138 0.17
139 0.1
140 0.12
141 0.11
142 0.1
143 0.09
144 0.1
145 0.12
146 0.16
147 0.16
148 0.15
149 0.17
150 0.18
151 0.2
152 0.21
153 0.21
154 0.17
155 0.17
156 0.2
157 0.21
158 0.2
159 0.2
160 0.2
161 0.22
162 0.22
163 0.24
164 0.21
165 0.18
166 0.2
167 0.27