Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PT77

Protein Details
Accession A0A3N2PT77   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32GPPPRRTIFKRKDLLRQHLRRMHBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039970  TF_Grauzone  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences SQSAMPASSGPPPRRTIFKRKDLLRQHLRRMHMPPADAAAASRKEPTPEWDERLRQLQADAETRRCALPTYMRCPVPDCKFKVRGPNAWDKRMEHVATHLERAAEGNGPRVQFGGDSDPTLTEWAEGDEVGVIRRNSGGEWELVNPLRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.59
4 0.6
5 0.66
6 0.7
7 0.72
8 0.79
9 0.79
10 0.82
11 0.82
12 0.8
13 0.8
14 0.77
15 0.76
16 0.71
17 0.66
18 0.64
19 0.56
20 0.49
21 0.4
22 0.36
23 0.32
24 0.26
25 0.22
26 0.19
27 0.17
28 0.16
29 0.18
30 0.15
31 0.17
32 0.18
33 0.22
34 0.24
35 0.26
36 0.3
37 0.34
38 0.36
39 0.36
40 0.4
41 0.36
42 0.29
43 0.26
44 0.24
45 0.21
46 0.25
47 0.25
48 0.22
49 0.22
50 0.23
51 0.22
52 0.19
53 0.17
54 0.13
55 0.19
56 0.22
57 0.26
58 0.3
59 0.31
60 0.31
61 0.33
62 0.38
63 0.36
64 0.38
65 0.37
66 0.38
67 0.44
68 0.45
69 0.52
70 0.5
71 0.5
72 0.48
73 0.55
74 0.54
75 0.52
76 0.53
77 0.44
78 0.44
79 0.44
80 0.39
81 0.28
82 0.26
83 0.29
84 0.27
85 0.27
86 0.24
87 0.18
88 0.17
89 0.18
90 0.16
91 0.13
92 0.12
93 0.15
94 0.17
95 0.17
96 0.17
97 0.16
98 0.16
99 0.12
100 0.14
101 0.15
102 0.13
103 0.14
104 0.15
105 0.15
106 0.15
107 0.16
108 0.14
109 0.08
110 0.08
111 0.08
112 0.08
113 0.07
114 0.07
115 0.08
116 0.08
117 0.09
118 0.13
119 0.12
120 0.12
121 0.13
122 0.14
123 0.13
124 0.16
125 0.17
126 0.14
127 0.16
128 0.17
129 0.22