Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PRG0

Protein Details
Accession A0A3N2PRG0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
65-88AYRDCRQAWMDKRREERRKAGYLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSSESPAADGPNTKGPWTEETKRKFETKSKSQYFDPCQDAAARSIRCLKRNNGDREMCGEYFQAYRDCRQAWMDKRREERRKAGYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.29
5 0.35
6 0.4
7 0.4
8 0.46
9 0.51
10 0.53
11 0.54
12 0.54
13 0.54
14 0.55
15 0.57
16 0.61
17 0.61
18 0.61
19 0.61
20 0.64
21 0.62
22 0.58
23 0.51
24 0.41
25 0.35
26 0.32
27 0.3
28 0.24
29 0.24
30 0.18
31 0.16
32 0.24
33 0.26
34 0.3
35 0.34
36 0.36
37 0.4
38 0.49
39 0.56
40 0.55
41 0.54
42 0.5
43 0.51
44 0.51
45 0.42
46 0.33
47 0.26
48 0.2
49 0.18
50 0.19
51 0.19
52 0.16
53 0.18
54 0.22
55 0.22
56 0.23
57 0.27
58 0.35
59 0.39
60 0.48
61 0.54
62 0.58
63 0.68
64 0.76
65 0.82
66 0.81
67 0.81
68 0.79