Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PMN3

Protein Details
Accession A0A3N2PMN3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MKQRERRRDRKRIRQRTKVCERQREKGESBasic
NLS Segment(s)
PositionSequence
4-53RERRRDRKRIRQRTKVCERQREKGESEKKESILKGMTKSKTSKSQTRRKS
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKQRERRRDRKRIRQRTKVCERQREKGESEKKESILKGMTKSKTSKSQTRRKSSREGIAGLLYDLIREVVAWMAEDGRTACWARDPESGRDGPAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.94
4 0.94
5 0.93
6 0.91
7 0.91
8 0.86
9 0.84
10 0.82
11 0.77
12 0.7
13 0.69
14 0.69
15 0.63
16 0.65
17 0.59
18 0.52
19 0.51
20 0.47
21 0.39
22 0.35
23 0.32
24 0.29
25 0.33
26 0.33
27 0.33
28 0.35
29 0.37
30 0.41
31 0.44
32 0.47
33 0.49
34 0.57
35 0.63
36 0.71
37 0.74
38 0.7
39 0.73
40 0.7
41 0.68
42 0.62
43 0.54
44 0.45
45 0.38
46 0.34
47 0.25
48 0.2
49 0.12
50 0.09
51 0.07
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.1
66 0.11
67 0.11
68 0.16
69 0.18
70 0.21
71 0.28
72 0.32
73 0.34
74 0.4
75 0.41