Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WWW4

Protein Details
Accession K1WWW4    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
9-39SPPRPDPTRYARRTKEKQKEKEEKEKEKEKEBasic
NLS Segment(s)
PositionSequence
17-62RYARRTKEKQKEKEEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEK
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
KEGG mbe:MBM_08601  -  
Amino Acid Sequences MFIHTFTHSPPRPDPTRYARRTKEKQKEKEEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEEGNQDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.6
4 0.62
5 0.67
6 0.68
7 0.73
8 0.79
9 0.82
10 0.83
11 0.83
12 0.86
13 0.87
14 0.89
15 0.86
16 0.87
17 0.86
18 0.85
19 0.82
20 0.81
21 0.74
22 0.73
23 0.73
24 0.7
25 0.7
26 0.68
27 0.7
28 0.69
29 0.74
30 0.72
31 0.74
32 0.74
33 0.74
34 0.74
35 0.74
36 0.74
37 0.74
38 0.74
39 0.74
40 0.74
41 0.74
42 0.74
43 0.74
44 0.74
45 0.75
46 0.71
47 0.71
48 0.67
49 0.66