Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M3H2

Protein Details
Accession E2M3H2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-29QSETRRRPLKKDEAIRRKNEMDBasic
NLS Segment(s)
PositionSequence
13-25RRPLKKDEAIRRK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000644  CBS_dom  
IPR046342  CBS_dom_sf  
KEGG mpr:MPER_14730  -  
Pfam View protein in Pfam  
PF00571  CBS  
PROSITE View protein in PROSITE  
PS51371  CBS  
Amino Acid Sequences MSSLSGLQSETRRRPLKKDEAIRRKNEMDLARKRTISINQNQHRSRRGHKSTAAKGTVAALRPTPALTVPENITVAEASQLCAAKRTDCVLVVDDEEGLSGIFTAKDLAYRLRLQFSICH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.7
4 0.71
5 0.75
6 0.77
7 0.8
8 0.85
9 0.83
10 0.8
11 0.72
12 0.64
13 0.6
14 0.55
15 0.54
16 0.54
17 0.56
18 0.54
19 0.52
20 0.5
21 0.48
22 0.48
23 0.47
24 0.46
25 0.49
26 0.52
27 0.61
28 0.64
29 0.64
30 0.63
31 0.59
32 0.58
33 0.58
34 0.57
35 0.54
36 0.57
37 0.62
38 0.62
39 0.65
40 0.58
41 0.48
42 0.41
43 0.37
44 0.33
45 0.25
46 0.19
47 0.11
48 0.11
49 0.11
50 0.11
51 0.09
52 0.07
53 0.09
54 0.09
55 0.11
56 0.11
57 0.12
58 0.13
59 0.12
60 0.12
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.09
67 0.1
68 0.1
69 0.13
70 0.13
71 0.12
72 0.14
73 0.16
74 0.15
75 0.15
76 0.17
77 0.15
78 0.16
79 0.16
80 0.15
81 0.12
82 0.1
83 0.09
84 0.08
85 0.06
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.08
94 0.1
95 0.13
96 0.17
97 0.22
98 0.25
99 0.28
100 0.29