Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q2M3

Protein Details
Accession A0A3N2Q2M3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-49IDVSVSSKIRKRPRRKPPRWPSTLLVHydrophilic
NLS Segment(s)
PositionSequence
29-42SSKIRKRPRRKPPR
Subcellular Location(s) nucl 13, cyto_nucl 9.833, mito 7.5, cyto_mito 6.666, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNHGWYEYGATGKKKVHMPWKRHIDVSVSSKIRKRPRRKPPRWPSTLLVFSLYSVLCTFRITWHEPLQNRGAEDSGDGSTLSTTRCGRSEETPADISVHDYTNMMQAHWLRKSMDSECEGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.48
4 0.53
5 0.57
6 0.63
7 0.71
8 0.69
9 0.65
10 0.6
11 0.53
12 0.51
13 0.5
14 0.48
15 0.4
16 0.41
17 0.43
18 0.5
19 0.56
20 0.6
21 0.64
22 0.66
23 0.74
24 0.82
25 0.88
26 0.92
27 0.92
28 0.93
29 0.88
30 0.83
31 0.75
32 0.72
33 0.64
34 0.53
35 0.44
36 0.33
37 0.27
38 0.23
39 0.19
40 0.11
41 0.09
42 0.09
43 0.07
44 0.07
45 0.08
46 0.08
47 0.12
48 0.15
49 0.18
50 0.22
51 0.27
52 0.27
53 0.3
54 0.32
55 0.29
56 0.27
57 0.24
58 0.19
59 0.14
60 0.14
61 0.12
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.09
70 0.1
71 0.11
72 0.13
73 0.16
74 0.18
75 0.21
76 0.29
77 0.28
78 0.31
79 0.3
80 0.29
81 0.28
82 0.25
83 0.24
84 0.19
85 0.17
86 0.13
87 0.12
88 0.12
89 0.17
90 0.17
91 0.14
92 0.16
93 0.19
94 0.26
95 0.27
96 0.3
97 0.26
98 0.29
99 0.34
100 0.33
101 0.36
102 0.32