Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PR16

Protein Details
Accession A0A3N2PR16    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-46RRDCDEKSRNHPRSRRRTQKRERDAARSTBasic
NLS Segment(s)
PositionSequence
11-41RGKVSKARRDCDEKSRNHPRSRRRTQKRERD
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MSPSLALQFKRGKVSKARRDCDEKSRNHPRSRRRTQKRERDAARSTQHHRSVRGVIPCLLGGWSQHKVGNTLTSGIYRQRCKVGGLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.7
5 0.68
6 0.73
7 0.73
8 0.73
9 0.71
10 0.67
11 0.66
12 0.72
13 0.74
14 0.74
15 0.77
16 0.77
17 0.79
18 0.84
19 0.85
20 0.85
21 0.88
22 0.89
23 0.93
24 0.92
25 0.91
26 0.84
27 0.81
28 0.73
29 0.7
30 0.65
31 0.59
32 0.55
33 0.53
34 0.56
35 0.5
36 0.48
37 0.44
38 0.43
39 0.42
40 0.41
41 0.35
42 0.29
43 0.27
44 0.25
45 0.22
46 0.18
47 0.13
48 0.11
49 0.13
50 0.14
51 0.14
52 0.16
53 0.17
54 0.18
55 0.19
56 0.21
57 0.18
58 0.18
59 0.17
60 0.17
61 0.18
62 0.24
63 0.3
64 0.3
65 0.33
66 0.37
67 0.37